Recombinant Human LTA4H protein, T7/His-tagged
| Cat.No. : | LTA4H-84H |
| Product Overview : | Recombinant human LTA4H cDNA ( 610 aa, derived from BC032528 ) fused with T7-His-TEV cleavage site Tag (31aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.20 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQS QEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQK VPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGG MENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALG GWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDL SSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRP LFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro LTA4H protein mediated inflammation / insulin resistance regulation in macrophage / liver cells study by intracellular delivery of this protein with "ProFectin" reagent.2. May be used for mapping LTA4H protein-protein interaction.3. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | LTA4H leukotriene A4 hydrolase [ Homo sapiens ] |
| Official Symbol | LTA4H |
| Synonyms | LTA4H; leukotriene A4 hydrolase; leukotriene A-4 hydrolase; LTA-4 hydrolase; FLJ17564; |
| Gene ID | 4048 |
| mRNA Refseq | NM_000895 |
| Protein Refseq | NP_000886 |
| MIM | 151570 |
| UniProt ID | P09960 |
| Chromosome Location | 12q22 |
| Pathway | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Leukotriene synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem |
| Function | aminopeptidase activity; binding; epoxide hydrolase activity; epoxide hydrolase activity; leukotriene-A4 hydrolase activity; leukotriene-A4 hydrolase activity; metal ion binding; metallopeptidase activity; peptidase activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| LTA4H-1096HFL | Recombinant Full Length Human LTA4H Protein, C-Flag-tagged | +Inquiry |
| LTA4H-6539H | Recombinant Human LTA4H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LTA4H-305H | Active Recombinant Human LTA4H protein, His-tagged | +Inquiry |
| LTA4H-074H | Recombinant Human LTA4H Protein, His-tagged | +Inquiry |
| LTA4H-4464H | Recombinant Human LTA4H Protein (Met1-Asp611), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LTA4H-731HCL | Recombinant Human LTA4H cell lysate | +Inquiry |
| LTA4H-653MCL | Recombinant Mouse LTA4H cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTA4H Products
Required fields are marked with *
My Review for All LTA4H Products
Required fields are marked with *
