Recombinant Human LTB4R Protein

Cat.No. : LTB4R-4592H
Product Overview : Human LTB4R full-length ORF (ABW03628.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : LTB4R (Leukotriene B4 Receptor) is a Protein Coding gene. Among its related pathways are Immune response CCR3 signaling in eosinophils and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and leukotriene receptor activity. An important paralog of this gene is LTB4R2.
Form : Liquid
Molecular Mass : 38.72 kDa
AA Sequence : MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPFKLNELN
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name LTB4R leukotriene B4 receptor [ Homo sapiens ]
Official Symbol LTB4R
Synonyms LTB4R; leukotriene B4 receptor; CMKRL1, GPR16, P2RY7; leukotriene B4 receptor 1; BLTR; LTB4R1; P2Y7; LTB4-R1; LTB4-R 1; P2Y purinoceptor 7; chemokine receptor-like 1; G protein-coupled receptor 16; G-protein coupled receptor 16; chemoattractant receptor-like 1; purinergic receptor P2Y, G-protein coupled, 7; BLT1; GPR16; LTBR1; P2RY7; CMKRL1;
Gene ID 1241
mRNA Refseq NM_001143919
Protein Refseq NP_001137391
MIM 601531
UniProt ID Q15722

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTB4R Products

Required fields are marked with *

My Review for All LTB4R Products

Required fields are marked with *

0

Inquiry Basket

cartIcon