Recombinant Human LTBP1
Cat.No. : | LTBP1-29149TH |
Product Overview : | Recombinant fragment of Human LTBP1 with an N terminal proprietary tag; Predicted MW 36.41kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Isoform Long is found in fibroblasts. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS |
Sequence Similarities : | Belongs to the LTBP family.Contains 18 EGF-like domains.Contains 4 TB (TGF-beta binding) domains. |
Gene Name | LTBP1 latent transforming growth factor beta binding protein 1 [ Homo sapiens ] |
Official Symbol | LTBP1 |
Synonyms | LTBP1; latent transforming growth factor beta binding protein 1; latent-transforming growth factor beta-binding protein 1; TGF beta1 BP 1; |
Gene ID | 4052 |
mRNA Refseq | NM_000627 |
Protein Refseq | NP_000618 |
MIM | 150390 |
Uniprot ID | Q14766 |
Chromosome Location | 2p22-p21 |
Pathway | TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | binding; calcium ion binding; growth factor binding; transforming growth factor beta-activated receptor activity; |
◆ Recombinant Proteins | ||
LTBP1-4591H | Recombinant Human LTBP1 Protein, GST-tagged | +Inquiry |
LTBP1-29149TH | Recombinant Human LTBP1 | +Inquiry |
LTBP1-9347M | Recombinant Mouse LTBP1 Protein | +Inquiry |
LTBP1-319H | Recombinant Human LTBP1 Protein, His-tagged | +Inquiry |
LTBP1-320H | Recombinant Human LTBP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTBP1 Products
Required fields are marked with *
My Review for All LTBP1 Products
Required fields are marked with *