Recombinant Human LTBP1

Cat.No. : LTBP1-29149TH
Product Overview : Recombinant fragment of Human LTBP1 with an N terminal proprietary tag; Predicted MW 36.41kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Isoform Long is found in fibroblasts.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS
Sequence Similarities : Belongs to the LTBP family.Contains 18 EGF-like domains.Contains 4 TB (TGF-beta binding) domains.
Gene Name LTBP1 latent transforming growth factor beta binding protein 1 [ Homo sapiens ]
Official Symbol LTBP1
Synonyms LTBP1; latent transforming growth factor beta binding protein 1; latent-transforming growth factor beta-binding protein 1; TGF beta1 BP 1;
Gene ID 4052
mRNA Refseq NM_000627
Protein Refseq NP_000618
MIM 150390
Uniprot ID Q14766
Chromosome Location 2p22-p21
Pathway TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function binding; calcium ion binding; growth factor binding; transforming growth factor beta-activated receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTBP1 Products

Required fields are marked with *

My Review for All LTBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon