Recombinant Human LTBP1 Protein, GST-tagged
Cat.No. : | LTBP1-4591H |
Product Overview : | Human LTBP1 partial ORF ( NP_000618, 403 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq |
Molecular Mass : | 36.52 kDa |
AA Sequence : | CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LTBP1 latent transforming growth factor beta binding protein 1 [ Homo sapiens ] |
Official Symbol | LTBP1 |
Synonyms | LTBP1; latent transforming growth factor beta binding protein 1; latent-transforming growth factor beta-binding protein 1; TGF beta1 BP 1; LTBP-1; TGF-beta1-BP-1; transforming growth factor beta-1-binding protein 1; MGC163161; |
Gene ID | 4052 |
mRNA Refseq | NM_000627 |
Protein Refseq | NP_000618 |
MIM | 150390 |
UniProt ID | Q14766 |
◆ Recombinant Proteins | ||
LTBP1-317H | Recombinant Human LTBP1 Protein, His-tagged | +Inquiry |
LTBP1-29149TH | Recombinant Human LTBP1 | +Inquiry |
LTBP1-5465C | Recombinant Chicken LTBP1 | +Inquiry |
LTBP1-319H | Recombinant Human LTBP1 Protein, His-tagged | +Inquiry |
Ltbp1-318M | Recombinant Mouse Ltbp1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTBP1 Products
Required fields are marked with *
My Review for All LTBP1 Products
Required fields are marked with *
0
Inquiry Basket