Recombinant Human LTBP1 Protein, GST-tagged

Cat.No. : LTBP1-4591H
Product Overview : Human LTBP1 partial ORF ( NP_000618, 403 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Molecular Mass : 36.52 kDa
AA Sequence : CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LTBP1 latent transforming growth factor beta binding protein 1 [ Homo sapiens ]
Official Symbol LTBP1
Synonyms LTBP1; latent transforming growth factor beta binding protein 1; latent-transforming growth factor beta-binding protein 1; TGF beta1 BP 1; LTBP-1; TGF-beta1-BP-1; transforming growth factor beta-1-binding protein 1; MGC163161;
Gene ID 4052
mRNA Refseq NM_000627
Protein Refseq NP_000618
MIM 150390
UniProt ID Q14766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTBP1 Products

Required fields are marked with *

My Review for All LTBP1 Products

Required fields are marked with *

0
cart-icon