Recombinant Human LTBP1 Protein, His-tagged

• Cat.No.: LTBP1-319H
• Product Overview: Recombinant Human LTBP1 Protein(NP_000618)(600-739 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 600-739 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: LTBP1 latent transforming growth factor beta binding protein 1 [ Homo sapiens ]
• Official Symbol: LTBP1
• Synonyms: LTBP1; latent transforming growth factor beta binding protein 1; latent-transforming growth factor beta-binding protein 1; TGF beta1 BP 1; LTBP-1; TGF-beta1-BP-1; transforming growth factor beta-1-binding protein 1; MGC163161
• Gene ID: 4052
• mRNA Refseq: NM_000627
• Protein Refseq: NP_000618
• MIM: 150390
• UniProt ID: Q14766