Recombinant Human LTBP1 Protein, His-tagged
| Cat.No. : | LTBP1-319H |
| Product Overview : | Recombinant Human LTBP1 Protein(NP_000618)(600-739 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 600-739 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LTBP1 latent transforming growth factor beta binding protein 1 [ Homo sapiens ] |
| Official Symbol | LTBP1 |
| Synonyms | LTBP1; latent transforming growth factor beta binding protein 1; latent-transforming growth factor beta-binding protein 1; TGF beta1 BP 1; LTBP-1; TGF-beta1-BP-1; transforming growth factor beta-1-binding protein 1; MGC163161; |
| Gene ID | 4052 |
| mRNA Refseq | NM_000627 |
| Protein Refseq | NP_000618 |
| MIM | 150390 |
| UniProt ID | Q14766 |
| ◆ Recombinant Proteins | ||
| LTBP1-29149TH | Recombinant Human LTBP1 | +Inquiry |
| LTBP1-317H | Recombinant Human LTBP1 Protein, His-tagged | +Inquiry |
| LTBP1-3156R | Recombinant Rat LTBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LTBP1-3500R | Recombinant Rat LTBP1 Protein | +Inquiry |
| Ltbp1-318M | Recombinant Mouse Ltbp1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTBP1 Products
Required fields are marked with *
My Review for All LTBP1 Products
Required fields are marked with *
