Recombinant Human LTBP2 Protein, GST-tagged
Cat.No. : | LTBP2-4590H |
Product Overview : | Human LTBP2 partial ORF ( NP_000419, 1709 a.a. - 1818 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the family of latent transforming growth factor (TGF)-beta binding proteins (LTBP), which are extracellular matrix proteins with multi-domain structure. This protein is the largest member of the LTBP family possessing unique regions and with most similarity to the fibrillins. It has thus been suggested that it may have multiple functions: as a member of the TGF-beta latent complex, as a structural component of microfibrils, and a role in cell adhesion. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LTBP2 latent transforming growth factor beta binding protein 2 [ Homo sapiens ] |
Official Symbol | LTBP2 |
Synonyms | LTBP2; latent transforming growth factor beta binding protein 2; C14orf141, chromosome 14 open reading frame 141 , LTBP3; latent-transforming growth factor beta-binding protein 2; LTBP-2; GLC3D; LTBP3; MSTP031; C14orf141; |
Gene ID | 4053 |
mRNA Refseq | NM_000428 |
Protein Refseq | NP_000419 |
MIM | 602091 |
UniProt ID | Q14767 |
◆ Recombinant Proteins | ||
LTBP2-9349MFL | Recombinant Full Length Mouse LTBP2 Protein, Flag-tagged | +Inquiry |
LTBP2-4590H | Recombinant Human LTBP2 Protein, GST-tagged | +Inquiry |
LTBP2-5238M | Recombinant Mouse LTBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LTBP2-663H | Recombinant Human LTBP2 protein, GST-tagged | +Inquiry |
LTBP2-664H | Recombinant Human LTBP2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTBP2 Products
Required fields are marked with *
My Review for All LTBP2 Products
Required fields are marked with *
0
Inquiry Basket