Recombinant Human LTBP2 Protein, GST-tagged

Cat.No. : LTBP2-4590H
Product Overview : Human LTBP2 partial ORF ( NP_000419, 1709 a.a. - 1818 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the family of latent transforming growth factor (TGF)-beta binding proteins (LTBP), which are extracellular matrix proteins with multi-domain structure. This protein is the largest member of the LTBP family possessing unique regions and with most similarity to the fibrillins. It has thus been suggested that it may have multiple functions: as a member of the TGF-beta latent complex, as a structural component of microfibrils, and a role in cell adhesion. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LTBP2 latent transforming growth factor beta binding protein 2 [ Homo sapiens ]
Official Symbol LTBP2
Synonyms LTBP2; latent transforming growth factor beta binding protein 2; C14orf141, chromosome 14 open reading frame 141 , LTBP3; latent-transforming growth factor beta-binding protein 2; LTBP-2; GLC3D; LTBP3; MSTP031; C14orf141;
Gene ID 4053
mRNA Refseq NM_000428
Protein Refseq NP_000419
MIM 602091
UniProt ID Q14767

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTBP2 Products

Required fields are marked with *

My Review for All LTBP2 Products

Required fields are marked with *

0
cart-icon