Recombinant Human LTBR Protein, GST-tagged
Cat.No. : | LTBR-4589H |
Product Overview : | Human LTBR full-length ORF ( AAH26262, 31 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial and myeloid lineages, but not on T and B lymphocytes. The protein specifically binds the lymphotoxin membrane form (a complex of lymphotoxin-alpha and lymphtoxin-beta). The encoded protein and its ligand play a role in the development and organization of lymphoid tissue and tranformed cells. Activation of the encoded protein can trigger apoptosis. [provided by RefSeq |
Molecular Mass : | 70.29 kDa |
AA Sequence : | QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LTBR lymphotoxin beta receptor (TNFR superfamily, member 3) [ Homo sapiens ] |
Official Symbol | LTBR |
Synonyms | LTBR; lymphotoxin beta receptor (TNFR superfamily, member 3); D12S370; tumor necrosis factor receptor superfamily member 3; TNF R III; TNFCR; TNFR RP; TNFR2 RP; TNFRSF3; TNF-RIII; TNFR-III; lymphotoxin B receptor; lymphotoxin-beta receptor; TNFR superfamily, member 3; tumor necrosis factor C receptor; tumor necrosis factor receptor type III; tumor necrosis factor receptor 2-related protein; tumor necrosis factor receptor superfamily, member 3; CD18; TNFR-RP; TNFR2-RP; LT-BETA-R; TNF-R-III; |
Gene ID | 4055 |
mRNA Refseq | NM_002342 |
Protein Refseq | NP_002333 |
MIM | 600979 |
UniProt ID | P36941 |
◆ Recombinant Proteins | ||
LTBR-6208HF | Recombinant Full Length Human LTBR Protein, GST-tagged | +Inquiry |
LTBR-5243H | Recombinant Human LTBR protein, His-tagged | +Inquiry |
LTBR-2591R | Recombinant Rhesus monkey LTBR Protein, His-tagged | +Inquiry |
LTBR-399H | Recombinant Human LTBR protein, Fc-tagged | +Inquiry |
LTBR-380R | Recombinant Rat Ltbr, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTBR-1052RCL | Recombinant Rat LTBR cell lysate | +Inquiry |
LTBR-1229CCL | Recombinant Cynomolgus LTBR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTBR Products
Required fields are marked with *
My Review for All LTBR Products
Required fields are marked with *
0
Inquiry Basket