Recombinant Human LTV1 protein, GST-tagged
Cat.No. : | LTV1-301445H |
Product Overview : | Recombinant Human LTV1 (283-372 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn283-Lys372 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NAELEGSIQVDSNRLQEVLNDYYKEKAENCVKLNTLEPLEDQDLPMNELDESEEEEMITVVLEEAKEKWDCESICSTYSNLYNHPQLIKYQPK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LTV1 LTV1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | LTV1 |
Synonyms | C6orf93; dJ468K18.4 |
Gene ID | 84946 |
mRNA Refseq | NM_032860.3 |
Protein Refseq | NP_116249.2 |
UniProt ID | Q96GA3 |
◆ Recombinant Proteins | ||
LTV1-3159R | Recombinant Rat LTV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LTV1-4584H | Recombinant Human LTV1 Protein, GST-tagged | +Inquiry |
LTV1-465Z | Recombinant Zebrafish LTV1 | +Inquiry |
LTV1-6214HF | Recombinant Full Length Human LTV1 Protein, GST-tagged | +Inquiry |
LTV1-5242M | Recombinant Mouse LTV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTV1-4608HCL | Recombinant Human LTV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTV1 Products
Required fields are marked with *
My Review for All LTV1 Products
Required fields are marked with *