Recombinant Human LXN Protein, GST-tagged
| Cat.No. : | LXN-4573H |
| Product Overview : | Human LXN full-length ORF ( NP_064554.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq |
| Molecular Mass : | 52.2 kDa |
| AA Sequence : | MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LXN latexin [ Homo sapiens ] |
| Official Symbol | LXN |
| Synonyms | LXN; latexin; MUM; tissue carboxypeptidase inhibitor; endogenous carboxypeptidase inhibitor; ECI; TCI; |
| Gene ID | 56925 |
| mRNA Refseq | NM_020169 |
| Protein Refseq | NP_064554 |
| MIM | 609305 |
| UniProt ID | Q9BS40 |
| ◆ Recombinant Proteins | ||
| LXN-1218H | Recombinant Human LXN Protein, MYC/DDK-tagged | +Inquiry |
| LXN-795H | Recombinant Human LXN, Fc tagged | +Inquiry |
| LXN-4881C | Recombinant Chicken LXN | +Inquiry |
| LXN-1893Z | Recombinant Zebrafish LXN | +Inquiry |
| LXN-3163R | Recombinant Rat LXN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LXN-2898HCL | Recombinant Human LXN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LXN Products
Required fields are marked with *
My Review for All LXN Products
Required fields are marked with *
