Recombinant Human LXN protein, His-tagged
Cat.No. : | LXN-2846H |
Product Overview : | Recombinant Human LXN protein(1-222 aa), fused to His tag, was expressed in E. coli. |
Availability | September 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-222 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LXN latexin [ Homo sapiens ] |
Official Symbol | LXN |
Synonyms | LXN; latexin; MUM; tissue carboxypeptidase inhibitor; endogenous carboxypeptidase inhibitor; ECI; TCI; |
Gene ID | 56925 |
mRNA Refseq | NM_020169 |
Protein Refseq | NP_064554 |
MIM | 609305 |
UniProt ID | Q9BS40 |
◆ Recombinant Proteins | ||
LXN-1893Z | Recombinant Zebrafish LXN | +Inquiry |
Lxn-1552R | Recombinant Rat Lxn protein, His-tagged | +Inquiry |
LXN-4881C | Recombinant Chicken LXN | +Inquiry |
LXN-9364M | Recombinant Mouse LXN Protein | +Inquiry |
LXN-172H | Recombinant Human LXN protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LXN-2898HCL | Recombinant Human LXN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LXN Products
Required fields are marked with *
My Review for All LXN Products
Required fields are marked with *