Recombinant Human LXN protein, T7-tagged
Cat.No. : | LXN-172H |
Product Overview : | Recombinant human LXN (222aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 222 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEE IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTL VLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK HNSRLPKEVQLE |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | LXN latexin [ Homo sapiens ] |
Official Symbol | LXN |
Synonyms | LXN; latexin; MUM; tissue carboxypeptidase inhibitor; endogenous carboxypeptidase inhibitor; ECI; TCI; |
Gene ID | 56925 |
mRNA Refseq | NM_020169 |
Protein Refseq | NP_064554 |
MIM | 609305 |
UniProt ID | Q9BS40 |
Chromosome Location | 3q25.32 |
Function | enzyme inhibitor activity; metalloendopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
Lxn-1552R | Recombinant Rat Lxn protein, His-tagged | +Inquiry |
Lxn-7273M | Recombinant Mouse Lxn Protein, His-tagged | +Inquiry |
LXN-129H | Recombinant Human Latexin | +Inquiry |
LXN-1893Z | Recombinant Zebrafish LXN | +Inquiry |
LXN-2595R | Recombinant Rhesus monkey LXN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LXN-2898HCL | Recombinant Human LXN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LXN Products
Required fields are marked with *
My Review for All LXN Products
Required fields are marked with *