Recombinant Human LY6D Protein, GST-tagged

• Cat.No.: LY6D-4571H
• Product Overview: Human LY6D full-length ORF ( AAH31330, 21 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LY6D (Lymphocyte Antigen 6 Family Member D) is a Protein Coding gene. Diseases associated with LY6D include Squamous Cell Carcinoma, Head And Neck. Among its related pathways are B Cell Development Pathways and Post-translational modification- synthesis of GPI-anchored proteins.
• Molecular Mass: 37.62 kDa
• AA Sequence: LRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LY6D lymphocyte antigen 6 complex, locus D [ Homo sapiens ]
• Official Symbol: LY6D
• Synonyms: LY6D; lymphocyte antigen 6 complex, locus D; lymphocyte antigen 6D; E48; e48 antigen; Ly-6D
• Gene ID: 8581
• mRNA Refseq: NM_003695
• Protein Refseq: NP_003686
• MIM: 606204
• UniProt ID: Q14210