Recombinant Human LY6G6D Protein(10-104aa), His-tagged
Cat.No. : | LY6G6D-9182H |
Product Overview : | Recombinant Human LY6G6D Protein(10-104aa)(Q14790), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 10-104aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.0 kDa |
AA Sequence : | LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
◆ Recombinant Proteins | ||
LY6G6D-3165R | Recombinant Rat LY6G6D Protein, His (Fc)-Avi-tagged | +Inquiry |
LY6G6D-3190H | Recombinant Human LY6G6D protein, His-B2M-JD-tagged | +Inquiry |
LY6G6D-4633C | Recombinant Cynomolgus monkey LY6G6D protein, His-tagged | +Inquiry |
Ly6g6d-4533M | Recombinant Mouse Ly6g6d protein, His-tagged | +Inquiry |
LY6G6D-9373M | Recombinant Mouse LY6G6D Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6G6D-4599HCL | Recombinant Human LY6G6D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6G6D Products
Required fields are marked with *
My Review for All LY6G6D Products
Required fields are marked with *
0
Inquiry Basket