Recombinant Human LY6G6D Protein (20-104 aa), His-tagged
| Cat.No. : | LY6G6D-1449H |
| Product Overview : | Recombinant Human LY6G6D Protein (20-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 20-104 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 11.1 kDa |
| AA Sequence : | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | LY6G6D lymphocyte antigen 6 family member G6D [ Homo sapiens (human) ] |
| Official Symbol | LY6G6D |
| Synonyms | G6D; NG25; LY6-D; MEGT1; C6orf23; |
| Gene ID | 58530 |
| mRNA Refseq | NM_021246 |
| Protein Refseq | NP_067069 |
| UniProt ID | O95868 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6G6D Products
Required fields are marked with *
My Review for All LY6G6D Products
Required fields are marked with *
