Recombinant Human LY6G6D Protein (20-104 aa), His-tagged
Cat.No. : | LY6G6D-1449H |
Product Overview : | Recombinant Human LY6G6D Protein (20-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-104 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.1 kDa |
AA Sequence : | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | LY6G6D lymphocyte antigen 6 family member G6D [ Homo sapiens (human) ] |
Official Symbol | LY6G6D |
Synonyms | G6D; NG25; LY6-D; MEGT1; C6orf23; |
Gene ID | 58530 |
mRNA Refseq | NM_021246 |
Protein Refseq | NP_067069 |
UniProt ID | O95868 |
◆ Recombinant Proteins | ||
LY6G6D-9182H | Recombinant Human LY6G6D Protein(10-104aa), His-tagged | +Inquiry |
LY6G6D-214H | Active Recombinant Human LY6G6D protein, hFc-tagged | +Inquiry |
LY6G6D-3509R | Recombinant Rat LY6G6D Protein | +Inquiry |
LY6G6D-3165R | Recombinant Rat LY6G6D Protein, His (Fc)-Avi-tagged | +Inquiry |
Ly6g6d-4533M | Recombinant Mouse Ly6g6d protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6G6D-4599HCL | Recombinant Human LY6G6D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6G6D Products
Required fields are marked with *
My Review for All LY6G6D Products
Required fields are marked with *
0
Inquiry Basket