Recombinant Human LY6G6D Protein (20-104 aa), His-tagged

Cat.No. : LY6G6D-1449H
Product Overview : Recombinant Human LY6G6D Protein (20-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 20-104 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.1 kDa
AA Sequence : NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name LY6G6D lymphocyte antigen 6 family member G6D [ Homo sapiens (human) ]
Official Symbol LY6G6D
Synonyms G6D; NG25; LY6-D; MEGT1; C6orf23;
Gene ID 58530
mRNA Refseq NM_021246
Protein Refseq NP_067069
UniProt ID O95868

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6G6D Products

Required fields are marked with *

My Review for All LY6G6D Products

Required fields are marked with *

0
cart-icon
0
compare icon