Recombinant Human LY6G6D Protein (20-104 aa), His-tagged

• Cat.No.: LY6G6D-1449H
• Product Overview: Recombinant Human LY6G6D Protein (20-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 20-104 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.1 kDa
• AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: LY6G6D lymphocyte antigen 6 family member G6D [ Homo sapiens (human) ]
• Official Symbol: LY6G6D
• Synonyms: G6D; NG25; LY6-D; MEGT1; C6orf23
• Gene ID: 58530
• mRNA Refseq: NM_021246
• Protein Refseq: NP_067069
• UniProt ID: O95868