Recombinant Human LY6H Protein, GST-tagged
Cat.No. : | LY6H-4568H |
Product Overview : | Human LY6H full-length ORF ( AAH28894, 26 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LY6H (Lymphocyte Antigen 6 Family Member H) is a Protein Coding gene. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. |
Molecular Mass : | 38.39 kDa |
AA Sequence : | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ] |
Official Symbol | LY6H |
Synonyms | LY6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6; ly-6H; |
Gene ID | 4062 |
mRNA Refseq | NM_001130478 |
Protein Refseq | NP_001123950 |
MIM | 603625 |
UniProt ID | O94772 |
◆ Recombinant Proteins | ||
Ly6h-3871M | Recombinant Mouse Ly6h Protein, Myc/DDK-tagged | +Inquiry |
LY6H-131H | Recombinant Human LY6H, His-tagged | +Inquiry |
LY6H-1927H | Recombinant Human LY6H Protein (26-115 aa), His-tagged | +Inquiry |
LY6H-667C | Recombinant Cynomolgus LY6H Protein, His-tagged | +Inquiry |
LY6H-2419R | Recombinant Rhesus Macaque LY6H Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6H-4598HCL | Recombinant Human LY6H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6H Products
Required fields are marked with *
My Review for All LY6H Products
Required fields are marked with *
0
Inquiry Basket