Recombinant Human LY6H Protein (26-115 aa), His-tagged

• Cat.No.: LY6H-1927H
• Product Overview: Recombinant Human LY6H Protein (26-115 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 26-115 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.9 kDa
• AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ]
• Official Symbol: LY6H
• Synonyms: LY6H; lymphocyte antigen 6H; NMLY6; ly-6H
• Gene ID: 4062
• mRNA Refseq: NM_001130478
• Protein Refseq: NP_001123950
• MIM: 603625
• UniProt ID: O94772