Recombinant Human LY6H Protein (26-115 aa), His-tagged
Cat.No. : | LY6H-1927H |
Product Overview : | Recombinant Human LY6H Protein (26-115 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 26-115 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.9 kDa |
AA Sequence : | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ] |
Official Symbol | LY6H |
Synonyms | LY6H; lymphocyte antigen 6H; NMLY6; ly-6H; |
Gene ID | 4062 |
mRNA Refseq | NM_001130478 |
Protein Refseq | NP_001123950 |
MIM | 603625 |
UniProt ID | O94772 |
◆ Recombinant Proteins | ||
LY6H-1927H | Recombinant Human LY6H Protein (26-115 aa), His-tagged | +Inquiry |
LY6H-1044H | Recombinant Human LY6H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LY6H-667C | Recombinant Cynomolgus LY6H Protein, His-tagged | +Inquiry |
LY6H-4472H | Recombinant Human LY6H Protein (Leu26-Gly115), C-His tagged | +Inquiry |
LY6H-6229HF | Recombinant Full Length Human LY6H Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6H-4598HCL | Recombinant Human LY6H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6H Products
Required fields are marked with *
My Review for All LY6H Products
Required fields are marked with *
0
Inquiry Basket