Recombinant Human LY6H Protein (26-115 aa), His-tagged
| Cat.No. : | LY6H-1927H |
| Product Overview : | Recombinant Human LY6H Protein (26-115 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 26-115 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 11.9 kDa |
| AA Sequence : | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ] |
| Official Symbol | LY6H |
| Synonyms | LY6H; lymphocyte antigen 6H; NMLY6; ly-6H; |
| Gene ID | 4062 |
| mRNA Refseq | NM_001130478 |
| Protein Refseq | NP_001123950 |
| MIM | 603625 |
| UniProt ID | O94772 |
| ◆ Recombinant Proteins | ||
| LY6H-1927H | Recombinant Human LY6H Protein (26-115 aa), His-tagged | +Inquiry |
| LY6H-4568H | Recombinant Human LY6H Protein, GST-tagged | +Inquiry |
| LY6H-131H | Recombinant Human LY6H, His-tagged | +Inquiry |
| LY6H-413C | Recombinant Cynomolgus Monkey LY6H Protein, His (Fc)-Avi-tagged | +Inquiry |
| LY6H-1044H | Recombinant Human LY6H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY6H-4598HCL | Recombinant Human LY6H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6H Products
Required fields are marked with *
My Review for All LY6H Products
Required fields are marked with *




