Recombinant Human LY96, GST-tagged
Cat.No. : | LY96-154H |
Product Overview : | Recombinant Human LY96(19 a.a. - 160 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 41.36 kDa |
AA Sequence : | QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEV ICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LY96 lymphocyte antigen 96 [ Homo sapiens ] |
Official Symbol | LY96 |
Synonyms | LY96; lymphocyte antigen 96; MD2; MD-2; ly-96; ESOP-1; myeloid differentiation protein-2; MD-2 protein; protein MD-2 |
Gene ID | 23643 |
mRNA Refseq | NM_015364 |
Protein Refseq | NP_056179 |
MIM | 605243 |
UniProt ID | Q9Y6Y9 |
Chromosome Location | 8q21.11 |
Pathway | Pathogenic Escherichia coli infection; Toll-like receptor signaling pathway; Signaling in Immune system |
Function | coreceptor activity; lipopolysaccharide receptor activity; protein binding |
◆ Recombinant Proteins | ||
LY96-2240H | Recombinant Human LY96 protein, His-tagged | +Inquiry |
Ly96-3875M | Recombinant Mouse Ly96 Protein, Myc/DDK-tagged | +Inquiry |
LY96-0381H | Recombinant Human LY96 Protein (Gln19-Asn160), C-His-tagged | +Inquiry |
Ly96-1551M | Recombinant Mouse Ly96 protein, His-tagged | +Inquiry |
LY96-154H | Recombinant Human LY96, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY96-771MCL | Recombinant Mouse LY96 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY96 Products
Required fields are marked with *
My Review for All LY96 Products
Required fields are marked with *
0
Inquiry Basket