Recombinant Human LY96, GST-tagged

Cat.No. : LY96-154H
Product Overview : Recombinant Human LY96(19 a.a. - 160 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 41.36 kDa
AA Sequence : QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEV ICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LY96 lymphocyte antigen 96 [ Homo sapiens ]
Official Symbol LY96
Synonyms LY96; lymphocyte antigen 96; MD2; MD-2; ly-96; ESOP-1; myeloid differentiation protein-2; MD-2 protein; protein MD-2
Gene ID 23643
mRNA Refseq NM_015364
Protein Refseq NP_056179
MIM 605243
UniProt ID Q9Y6Y9
Chromosome Location 8q21.11
Pathway Pathogenic Escherichia coli infection; Toll-like receptor signaling pathway; Signaling in Immune system
Function coreceptor activity; lipopolysaccharide receptor activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY96 Products

Required fields are marked with *

My Review for All LY96 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon