Recombinant Human LY96 Protein, His-tagged

Cat.No. : LY96-4159H
Product Overview : Recombinant Human LY96 protein(Glu17-Asn160), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Glu17-Asn160
Tag : N-His
Form : Liquid in sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose.
Molecular Mass : The protein has a calculated MW of 19 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.65 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MGSSHHHHHHHHSSGLVPRGSEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Gene Name LY96 lymphocyte antigen 96 [ Homo sapiens ]
Official Symbol LY96
Synonyms LY96; lymphocyte antigen 96; MD 2; protein MD-2; myeloid differentiation protein-2; MD2; MD-2; ly-96; ESOP-1;
Gene ID 23643
mRNA Refseq NM_001195797
Protein Refseq NP_001182726
MIM 605243
UniProt ID Q9Y6Y9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY96 Products

Required fields are marked with *

My Review for All LY96 Products

Required fields are marked with *

0
cart-icon
0
compare icon