Recombinant Human LY96 Protein, His-tagged
Cat.No. : | LY96-4159H |
Product Overview : | Recombinant Human LY96 protein(Glu17-Asn160), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Glu17-Asn160 |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol, 5% Trehalose. |
Molecular Mass : | The protein has a calculated MW of 19 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -20 to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.65 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHHHSSGLVPRGSEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN |
Gene Name | LY96 lymphocyte antigen 96 [ Homo sapiens ] |
Official Symbol | LY96 |
Synonyms | LY96; lymphocyte antigen 96; MD 2; protein MD-2; myeloid differentiation protein-2; MD2; MD-2; ly-96; ESOP-1; |
Gene ID | 23643 |
mRNA Refseq | NM_001195797 |
Protein Refseq | NP_001182726 |
MIM | 605243 |
UniProt ID | Q9Y6Y9 |
◆ Recombinant Proteins | ||
LY96-4157H | Recombinant Human LY96 Protein | +Inquiry |
LY96-3192H | Recombinant Human LY96 protein, His-tagged | +Inquiry |
LY96-1548H | Recombinant Human Lymphocyte Antigen 96, His-tagged | +Inquiry |
LY96-327H | Recombinant Human LY96 protein, MYC/DDK-tagged | +Inquiry |
LY96-4159H | Recombinant Human LY96 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY96-771MCL | Recombinant Mouse LY96 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY96 Products
Required fields are marked with *
My Review for All LY96 Products
Required fields are marked with *
0
Inquiry Basket