Recombinant Human LYL1 Protein, GST-tagged

• Cat.No.: LYL1-4558H
• Product Overview: Human LYL1 full-length ORF (AAH02796.2, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by RefSeq, Sep 2010]
• Molecular Mass: 57.2 kDa
• AA Sequence: MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYL1 lymphoblastic leukemia derived sequence 1 [ Homo sapiens ]
• Official Symbol: LYL1
• Synonyms: LYL1; lymphoblastic leukemia derived sequence 1; protein lyl-1; bHLHa18; class A basic helix-loop-helix protein 18
• Gene ID: 4066
• mRNA Refseq: NM_005583
• Protein Refseq: NP_005574
• MIM: 151440
• UniProt ID: P12980