Recombinant Human LYL1 Protein, GST-tagged
| Cat.No. : | LYL1-4558H |
| Product Overview : | Human LYL1 full-length ORF (AAH02796.2, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by RefSeq, Sep 2010] |
| Molecular Mass : | 57.2 kDa |
| AA Sequence : | MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYL1 lymphoblastic leukemia derived sequence 1 [ Homo sapiens ] |
| Official Symbol | LYL1 |
| Synonyms | LYL1; lymphoblastic leukemia derived sequence 1; protein lyl-1; bHLHa18; class A basic helix-loop-helix protein 18; |
| Gene ID | 4066 |
| mRNA Refseq | NM_005583 |
| Protein Refseq | NP_005574 |
| MIM | 151440 |
| UniProt ID | P12980 |
| ◆ Recombinant Proteins | ||
| LYL1-9385M | Recombinant Mouse LYL1 Protein | +Inquiry |
| LYL1-265H | Recombinant Human LYL1 | +Inquiry |
| LYL1-3513R | Recombinant Rat LYL1 Protein | +Inquiry |
| LYL1-5262M | Recombinant Mouse LYL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LYL1-663H | Recombinant Human LYL1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYL1-1042HCL | Recombinant Human LYL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYL1 Products
Required fields are marked with *
My Review for All LYL1 Products
Required fields are marked with *
