Recombinant Human LYPD1, His-tagged
Cat.No. : | LYPD1-132H |
Product Overview : | Recombinant Human Ly6/PLAUR Domain-Containing Protein 1/LYPD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu21-Ser117) of Human LYPD1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-117 a.a. |
Description : | Ly6/PLAUR Domain-Containing Protein 1 (LYPD1) is a cell membrane protein which contains one UPAR/Ly6 domain. LYPD1 preproprecursor is a 141 amino acids which contains a signal sequence (amino acids 1-20), a mature region (amino acids 21-117), and a propeptide (amino acids 118-141) that is cleaved from the preproprecursor. LYPD1 is expressed on postmitotic neurons in multiple locations, and it performs multiple functions. In addition, LYPD1 is a GPI-anchored protein. |
AA Sequence : | LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQ SFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | LYPD1 LY6/PLAUR domain containing 1 [ Homo sapiens ] |
Official Symbol | LYPD1 |
Synonyms | LYPD1; LY6/PLAUR domain containing 1; LYPDC1; ly6/PLAUR domain-containing protein 1; MGC29643; putative HeLa tumor suppressor; PHTS; FLJ41033; |
Gene ID | 116372 |
mRNA Refseq | NM_001077427 |
Protein Refseq | NP_001070895 |
MIM | 610450 |
UniProt ID | Q8N2G4 |
Chromosome Location | 2q21.2 |
◆ Recombinant Proteins | ||
LYPD1-5265M | Recombinant Mouse LYPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPD1-0366H | Recombinant Human LYPD1 protein, Fc-tagged | +Inquiry |
LYPD1-0364H | Recombinant Human LYPD1 protein, mFc-tagged | +Inquiry |
LYPD1-9237H | Active Recombinant Human LYPD1 protein, His-tagged | +Inquiry |
LYPD1-3515R | Recombinant Rat LYPD1 Protein | +Inquiry |
◆ Native Proteins | ||
LYPD1-001H | Recombinant Human LYPD1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPD1-4593HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
LYPD1-4592HCL | Recombinant Human LYPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD1 Products
Required fields are marked with *
My Review for All LYPD1 Products
Required fields are marked with *