Recombinant Human LYPD6 Protein (23-171 aa), His-tagged

Cat.No. : LYPD6--1685H
Product Overview : Recombinant Human LYPD6 Protein (23-171 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 23-171 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.8 kDa
AA Sequence : AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name LYPD6 LY6/PLAUR domain containing 6 [ Homo sapiens ]
Official Symbol LYPD6
Synonyms LYPD6; LY6/PLAUR domain containing 6; MGC52057;
Gene ID 130574
mRNA Refseq NM_001195685
Protein Refseq NP_001182614
MIM 613359
UniProt ID Q86Y78

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYPD6 Products

Required fields are marked with *

My Review for All LYPD6 Products

Required fields are marked with *

0
cart-icon
0
compare icon