Recombinant Human LYPD6 Protein (23-171 aa), His-tagged
Cat.No. : | LYPD6--1685H |
Product Overview : | Recombinant Human LYPD6 Protein (23-171 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 23-171 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.8 kDa |
AA Sequence : | AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | LYPD6 LY6/PLAUR domain containing 6 [ Homo sapiens ] |
Official Symbol | LYPD6 |
Synonyms | LYPD6; LY6/PLAUR domain containing 6; MGC52057; |
Gene ID | 130574 |
mRNA Refseq | NM_001195685 |
Protein Refseq | NP_001182614 |
MIM | 613359 |
UniProt ID | Q86Y78 |
◆ Recombinant Proteins | ||
LYPD6--1685H | Recombinant Human LYPD6 Protein (23-171 aa), His-tagged | +Inquiry |
LYPD6-1379Z | Recombinant Zebrafish LYPD6 | +Inquiry |
LYPD6-1052H | Recombinant Human LYPD6 Protein (23-171 aa), GST-tagged | +Inquiry |
LYPD6-2605R | Recombinant Rhesus monkey LYPD6 Protein, His-tagged | +Inquiry |
LYPD6-2425R | Recombinant Rhesus Macaque LYPD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD6 Products
Required fields are marked with *
My Review for All LYPD6 Products
Required fields are marked with *