Recombinant Human LYPLA1 protein, GST-tagged
Cat.No. : | LYPLA1-301277H |
Product Overview : | Recombinant Human LYPLA1 (1-230 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asp230 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LYPLA1 lysophospholipase I [ Homo sapiens ] |
Official Symbol | LYPLA1 |
Synonyms | LYPLA1; lysophospholipase I; acyl-protein thioesterase 1; LPL1; LPL-I; lysoPLA I; lysophospholipase 1; acyl-protein thioesterase-1; lysophospholipid-specific lysophospholipase; APT-1; hAPT1; LYSOPLA; |
Gene ID | 10434 |
mRNA Refseq | NM_006330 |
Protein Refseq | NP_006321 |
MIM | 605599 |
UniProt ID | O75608 |
◆ Recombinant Proteins | ||
LYPLA1-3173R | Recombinant Rat LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLA1-2426R | Recombinant Rhesus Macaque LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lypla1-3195M | Recombinant Mouse Lypla1 protein, GST-tagged | +Inquiry |
LYPLA1-5270M | Recombinant Mouse LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLA1-308H | Recombinant Human LYPLA1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLA1-4589HCL | Recombinant Human LYPLA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPLA1 Products
Required fields are marked with *
My Review for All LYPLA1 Products
Required fields are marked with *