Recombinant Human LYPLA1 protein, GST-tagged

• Cat.No.: LYPLA1-301277H
• Product Overview: Recombinant Human LYPLA1 (1-230 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Asp230
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: LYPLA1 lysophospholipase I [ Homo sapiens ]
• Official Symbol: LYPLA1
• Synonyms: LYPLA1; lysophospholipase I; acyl-protein thioesterase 1; LPL1; LPL-I; lysoPLA I; lysophospholipase 1; acyl-protein thioesterase-1; lysophospholipid-specific lysophospholipase; APT-1; hAPT1; LYSOPLA
• Gene ID: 10434
• mRNA Refseq: NM_006330
• Protein Refseq: NP_006321
• MIM: 605599
• UniProt ID: O75608