Recombinant Mouse Lypla1 protein, GST-tagged
| Cat.No. : | Lypla1-3195M |
| Product Overview : | Recombinant Mouse Lypla1 protein(P97823)(1-230aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-230aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.7 kDa |
| AA Sequence : | MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Lypla1 lysophospholipase 1 [ Mus musculus ] |
| Official Symbol | Lypla1 |
| Synonyms | LYPLA1; lysophospholipase 1; acyl-protein thioesterase 1; APT-1; LPL-I; lysoPLA I; phospholipase 1a; lysophopholipase 1; lysophospholipase I; Pla1a; |
| Gene ID | 18777 |
| mRNA Refseq | NM_008866 |
| Protein Refseq | NP_032892 |
| ◆ Recombinant Proteins | ||
| LYPLA1-7740H | Recombinant Human LYPLA1 Protein, His-tagged | +Inquiry |
| LYPLA1-6241HF | Recombinant Full Length Human LYPLA1 Protein, GST-tagged | +Inquiry |
| LYPLA1-2606R | Recombinant Rhesus monkey LYPLA1 Protein, His-tagged | +Inquiry |
| LYPLA1-3173R | Recombinant Rat LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lypla1-7904M | Recombinant Mouse Lypla1 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYPLA1-4589HCL | Recombinant Human LYPLA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lypla1 Products
Required fields are marked with *
My Review for All Lypla1 Products
Required fields are marked with *
