Recombinant Human LYPLA2, His-tagged
Cat.No. : | LYPLA2-28844TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-231 of Human LYPLA2, with N terminal His tag; 231 amino acids, 30kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-231 a.a. |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 77 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDL MGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRI VLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRA FPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLR SVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPP V |
Sequence Similarities : | Belongs to the AB hydrolase 2 family. |
Full Length : | Full L. |
Gene Name | LYPLA2 lysophospholipase II [ Homo sapiens ] |
Official Symbol | LYPLA2 |
Synonyms | LYPLA2; lysophospholipase II; acyl-protein thioesterase 2; APT 2; |
Gene ID | 11313 |
mRNA Refseq | NM_007260 |
Protein Refseq | NP_009191 |
Uniprot ID | O95372 |
Chromosome Location | 1p36.11 |
Pathway | Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; |
Function | hydrolase activity; |
◆ Recombinant Proteins | ||
LYPLA2-11012Z | Recombinant Zebrafish LYPLA2 | +Inquiry |
LYPLA2-2607R | Recombinant Rhesus monkey LYPLA2 Protein, His-tagged | +Inquiry |
LYPLA2-3174R | Recombinant Rat LYPLA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLA2-6242HF | Recombinant Full Length Human LYPLA2 Protein, GST-tagged | +Inquiry |
LYPLA2-3456H | Recombinant Human LYPLA2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLA2-4588HCL | Recombinant Human LYPLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPLA2 Products
Required fields are marked with *
My Review for All LYPLA2 Products
Required fields are marked with *