Recombinant Human LYPLAL1 Protein, GST-tagged
Cat.No. : | LYPLAL1-4543H |
Product Overview : | Human LYPLAL1 full-length ORF ( NP_620149.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | LYPLAL1 (Lysophospholipase Like 1) is a Protein Coding gene. Diseases associated with LYPLAL1 include Peters Anomaly. GO annotations related to this gene include hydrolase activity and lysophospholipase activity. An important paralog of this gene is LYPLA1. |
Molecular Mass : | 52.7 kDa |
AA Sequence : | MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYPLAL1 lysophospholipase-like 1 [ Homo sapiens ] |
Official Symbol | LYPLAL1 |
Synonyms | LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238; |
Gene ID | 127018 |
mRNA Refseq | NM_138794 |
Protein Refseq | NP_620149 |
UniProt ID | Q5VWZ2 |
◆ Recombinant Proteins | ||
LYPLAL1-2608R | Recombinant Rhesus monkey LYPLAL1 Protein, His-tagged | +Inquiry |
LYPLAL1-4953C | Recombinant Chicken LYPLAL1 | +Inquiry |
LYPLAL1-2428R | Recombinant Rhesus Macaque LYPLAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lyplal1-3880M | Recombinant Mouse Lyplal1 Protein, Myc/DDK-tagged | +Inquiry |
LYPLAL1-6958H | Recombinant Human Lysophospholipase-Like 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLAL1-4587HCL | Recombinant Human LYPLAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYPLAL1 Products
Required fields are marked with *
My Review for All LYPLAL1 Products
Required fields are marked with *
0
Inquiry Basket