Recombinant Human LYRM4 Protein, GST-tagged
| Cat.No. : | LYRM4-4540H |
| Product Overview : | Human LYRM4 full-length ORF (AAH09552.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016] |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYRM4 LYR motif containing 4 [ Homo sapiens ] |
| Official Symbol | LYRM4 |
| Synonyms | LYRM4; LYR motif containing 4; C6orf149, chromosome 6 open reading frame 149; LYR motif-containing protein 4; CGI 203; ISD11; homolog of yeast Isd11; mitochondrial matrix Nfs1 interacting protein; CGI-203; C6orf149; |
| Gene ID | 57128 |
| mRNA Refseq | NM_001164840 |
| Protein Refseq | NP_001158312 |
| MIM | 613311 |
| UniProt ID | Q9HD34 |
| ◆ Recombinant Proteins | ||
| LYRM4-5273M | Recombinant Mouse LYRM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LYRM4-7574Z | Recombinant Zebrafish LYRM4 | +Inquiry |
| LYRM4-6032HF | Recombinant Full Length Human LYRM4 Protein, GST-tagged | +Inquiry |
| LYRM4-9401M | Recombinant Mouse LYRM4 Protein | +Inquiry |
| LYRM4-4228C | Recombinant Chicken LYRM4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYRM4-4584HCL | Recombinant Human LYRM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYRM4 Products
Required fields are marked with *
My Review for All LYRM4 Products
Required fields are marked with *
