Recombinant Human lysine demethylase 3A Protein, His tagged
Cat.No. : | KDM3A-001H |
Product Overview : | Recombinant Human KDM3A Protein with His tag was expressed in E. coli. |
Availability | July 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 844-968 aa |
Description : | Enables histone H3K9me/H3K9me2 demethylase activity; iron ion binding activity; and nuclear androgen receptor binding activity. Involved in androgen receptor signaling pathway; formaldehyde biosynthetic process; and positive regulation of DNA-templated transcription. Located in nucleoplasm. Implicated in cervical cancer and colon cancer. Biomarker of Ewing sarcoma; hepatocellular carcinoma; nasopharynx carcinoma; and prostate cancer. |
Tag : | C-His |
Molecular Mass : | 15 kDa |
AA Sequence : | MPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGLKNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNKSNWNVFREHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile from PBS, pH7.4, 8% Trehalose, 10% Glycerol |
Concentration : | 1 mg/mL by BCA |
Gene Name | KDM3A lysine demethylase 3A [ Homo sapiens (human) ] |
Official Symbol | KDM3A |
Synonyms | KDM3A; lysine (K)-specific demethylase 3A; JMJD1, JMJD1A, jumonji domain containing 1, jumonji domain containing 1A; lysine-specific demethylase 3A; JHMD2A; jumonji C domain containing histone demethylase 2A; KIAA0742; TSGA; testis-specific protein A; jumonji domain containing 1; jumonji domain containing 1A; jumonji domain-containing protein 1A; jumonji C domain-containing histone demethylase 2A; jmjC domain-containing histone demethylation protein 2A; JMJD1; JHDM2A; JMJD1A; DKFZp686A24246; DKFZp686P07111 |
Gene ID | 55818 |
mRNA Refseq | NM_001146688 |
Protein Refseq | NP_001140160 |
MIM | 611512 |
UniProt ID | Q9Y4C1 |
◆ Recombinant Proteins | ||
KDM3A-2106C | Recombinant Chicken KDM3A | +Inquiry |
KDM3A-48H | Active Recombinant Human KDM3A, FLAG-tagged | +Inquiry |
KDM3A-8589M | Recombinant Mouse KDM3A Protein | +Inquiry |
KDM3A-4778M | Recombinant Mouse KDM3A Protein, His (Fc)-Avi-tagged | +Inquiry |
Kdm3a-255M | Recombinant Mouse Kdm3a Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM3A-4997HCL | Recombinant Human KDM3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM3A Products
Required fields are marked with *
My Review for All KDM3A Products
Required fields are marked with *