Recombinant Human lysine demethylase 3A Protein, His tagged

• Cat.No.: KDM3A-001H
• Product Overview: Recombinant Human KDM3A Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 844-968 aa
• Description: Enables histone H3K9me/H3K9me2 demethylase activity; iron ion binding activity; and nuclear androgen receptor binding activity. Involved in androgen receptor signaling pathway; formaldehyde biosynthetic process; and positive regulation of DNA-templated transcription. Located in nucleoplasm. Implicated in cervical cancer and colon cancer. Biomarker of Ewing sarcoma; hepatocellular carcinoma; nasopharynx carcinoma; and prostate cancer.
• Tag: C-His
• Molecular Mass: 15 kDa
• AA Sequence: MPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGLKNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNKSNWNVFREHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile from PBS, pH7.4, 8% Trehalose, 10% Glycerol
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: KDM3A lysine demethylase 3A [ Homo sapiens (human) ]
• Official Symbol: KDM3A
• Synonyms: KDM3A; lysine (K)-specific demethylase 3A; JMJD1, JMJD1A, jumonji domain containing 1, jumonji domain containing 1A; lysine-specific demethylase 3A; JHMD2A; jumonji C domain containing histone demethylase 2A; KIAA0742; TSGA; testis-specific protein A; jumonji domain containing 1; jumonji domain containing 1A; jumonji domain-containing protein 1A; jumonji C domain-containing histone demethylase 2A; jmjC domain-containing histone demethylation protein 2A; JMJD1; JHDM2A; JMJD1A; DKFZp686A24246; DKFZp686P07111
• Gene ID: 55818
• mRNA Refseq: NM_001146688
• Protein Refseq: NP_001140160
• MIM: 611512
• UniProt ID: Q9Y4C1