Recombinant Human lysine demethylase 3A Protein, His tagged

Cat.No. : KDM3A-001H
Product Overview : Recombinant Human KDM3A Protein with His tag was expressed in E. coli.
Availability July 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 844-968 aa
Description : Enables histone H3K9me/H3K9me2 demethylase activity; iron ion binding activity; and nuclear androgen receptor binding activity. Involved in androgen receptor signaling pathway; formaldehyde biosynthetic process; and positive regulation of DNA-templated transcription. Located in nucleoplasm. Implicated in cervical cancer and colon cancer. Biomarker of Ewing sarcoma; hepatocellular carcinoma; nasopharynx carcinoma; and prostate cancer.
Tag : C-His
Molecular Mass : 15 kDa
AA Sequence : MPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGLKNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNKSNWNVFREHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile from PBS, pH7.4, 8% Trehalose, 10% Glycerol
Concentration : 1 mg/mL by BCA
Gene Name KDM3A lysine demethylase 3A [ Homo sapiens (human) ]
Official Symbol KDM3A
Synonyms KDM3A; lysine (K)-specific demethylase 3A; JMJD1, JMJD1A, jumonji domain containing 1, jumonji domain containing 1A; lysine-specific demethylase 3A; JHMD2A; jumonji C domain containing histone demethylase 2A; KIAA0742; TSGA; testis-specific protein A; jumonji domain containing 1; jumonji domain containing 1A; jumonji domain-containing protein 1A; jumonji C domain-containing histone demethylase 2A; jmjC domain-containing histone demethylation protein 2A; JMJD1; JHDM2A; JMJD1A; DKFZp686A24246; DKFZp686P07111
Gene ID 55818
mRNA Refseq NM_001146688
Protein Refseq NP_001140160
MIM 611512
UniProt ID Q9Y4C1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDM3A Products

Required fields are marked with *

My Review for All KDM3A Products

Required fields are marked with *

0
cart-icon