Recombinant Human LYSMD3 protein, His-tagged
Cat.No. : | LYSMD3-3460H |
Product Overview : | Recombinant Human LYSMD3 protein(1-142 aa), fused to His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-142 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQYSSEQQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LYSMD3 LysM, putative peptidoglycan-binding, domain containing 3 [ Homo sapiens ] |
Official Symbol | LYSMD3 |
Gene ID | 116068 |
mRNA Refseq | NM_198273.1 |
Protein Refseq | NP_938014.1 |
UniProt ID | Q7Z3D4 |
◆ Recombinant Proteins | ||
LYSMD3-3522R | Recombinant Rat LYSMD3 Protein | +Inquiry |
LYSMD3-3178R | Recombinant Rat LYSMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lysmd3-5342M | Recombinant Mouse Lysmd3 protein, His&Myc-tagged | +Inquiry |
LYSMD3-6036HF | Recombinant Full Length Human LYSMD3 Protein, GST-tagged | +Inquiry |
LYSMD3-5276M | Recombinant Mouse LYSMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYSMD3 Products
Required fields are marked with *
My Review for All LYSMD3 Products
Required fields are marked with *