Recombinant Human LYSMD3 Protein, GST-tagged

Cat.No. : LYSMD3-4536H
Product Overview : Human LYSMD3 full-length ORF ( AAH58027.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LYSMD3 (LysM Domain Containing 3) is a Protein Coding gene. An important paralog of this gene is LYSMD4.
Molecular Mass : 40.7 kDa
AA Sequence : MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVYQNSSKKVQFLDRNTLSSKRKTDFTSFICSILFRTTGNFAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYSMD3 LysM, putative peptidoglycan-binding, domain containing 3 [ Homo sapiens ]
Official Symbol LYSMD3
Synonyms LYSMD3; LysM, putative peptidoglycan-binding, domain containing 3;
Gene ID 116068
mRNA Refseq NM_198273
Protein Refseq NP_938014
UniProt ID Q7Z3D4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYSMD3 Products

Required fields are marked with *

My Review for All LYSMD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon