Recombinant Human LYVE1, Fc-tagged

Cat.No. : LYVE1-28659TH
Product Overview : Recombinant fragment: LALLFFGAAA GLGFCYVKRY VKAFPFTNKN QQKEMIETKV VKEEKANDSN PNEESKKTDK NPEESKSPSK TTVRCLEAEV, corresponding to C terminal amino acids 243-322 of Human LYVE1 with tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Fc
Protein Length : 243-322 a.a.
Description : This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
Conjugation : Fc
Tissue specificity : Mainly expressed in endothelial cells lining lymphatic vessels.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : LALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV
Sequence Similarities : Contains 1 Link domain.
Gene Name LYVE1 lymphatic vessel endothelial hyaluronan receptor 1 [ Homo sapiens ]
Official Symbol LYVE1
Synonyms LYVE1; lymphatic vessel endothelial hyaluronan receptor 1; extracellular link domain containing 1 , XLKD1; lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE 1;
Gene ID 10894
mRNA Refseq NM_006691
Protein Refseq NP_006682
MIM 605702
Uniprot ID Q9Y5Y7
Chromosome Location 11p15
Function binding; hyaluronic acid binding; receptor activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYVE1 Products

Required fields are marked with *

My Review for All LYVE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon