Recombinant Human LYVE1, Fc-tagged

• Cat.No.: LYVE1-28659TH
• Product Overview: Recombinant fragment: LALLFFGAAA GLGFCYVKRY VKAFPFTNKN QQKEMIETKV VKEEKANDSN PNEESKKTDK NPEESKSPSK TTVRCLEAEV, corresponding to C terminal amino acids 243-322 of Human LYVE1 with tag.

Specification

• Species: Human
• Source: E.coli
• Tag: Fc
• Protein Length: 243-322 a.a.
• Description: This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
• Conjugation: Fc
• Tissue specificity: Mainly expressed in endothelial cells lining lymphatic vessels.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: LALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV
• Sequence Similarities: Contains 1 Link domain.

Gene Information

• Gene Name: LYVE1 lymphatic vessel endothelial hyaluronan receptor 1 [ Homo sapiens ]
• Official Symbol: LYVE1
• Synonyms: LYVE1; lymphatic vessel endothelial hyaluronan receptor 1; extracellular link domain containing 1 , XLKD1; lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE 1
• Gene ID: 10894
• mRNA Refseq: NM_006691
• Protein Refseq: NP_006682
• MIM: 605702
• Uniprot ID: Q9Y5Y7
• Chromosome Location: 11p15
• Function: binding; hyaluronic acid binding; receptor activity; transmembrane signaling receptor activity