Recombinant Human LYVE1, Fc-tagged
Cat.No. : | LYVE1-28659TH |
Product Overview : | Recombinant fragment: LALLFFGAAA GLGFCYVKRY VKAFPFTNKN QQKEMIETKV VKEEKANDSN PNEESKKTDK NPEESKSPSK TTVRCLEAEV, corresponding to C terminal amino acids 243-322 of Human LYVE1 with tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Fc |
Protein Length : | 243-322 a.a. |
Description : | This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. |
Conjugation : | Fc |
Tissue specificity : | Mainly expressed in endothelial cells lining lymphatic vessels. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV |
Sequence Similarities : | Contains 1 Link domain. |
Gene Name | LYVE1 lymphatic vessel endothelial hyaluronan receptor 1 [ Homo sapiens ] |
Official Symbol | LYVE1 |
Synonyms | LYVE1; lymphatic vessel endothelial hyaluronan receptor 1; extracellular link domain containing 1 , XLKD1; lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE 1; |
Gene ID | 10894 |
mRNA Refseq | NM_006691 |
Protein Refseq | NP_006682 |
MIM | 605702 |
Uniprot ID | Q9Y5Y7 |
Chromosome Location | 11p15 |
Function | binding; hyaluronic acid binding; receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
LYVE1-28659TH | Recombinant Human LYVE1, Fc-tagged | +Inquiry |
LYVE1-4404C | Recombinant Chicken LYVE1 | +Inquiry |
Lyve1-7148M | Recombinant Mouse Lyve1 Protein, His-tagged | +Inquiry |
LYVE1-5072H | Recombinant Human Lymphatic Vessel Endothelial Hyaluronan Receptor 1 | +Inquiry |
LYVE1-33H | Active Recombinant Human LYVE1 Protein, C-6×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYVE1-1937HCL | Recombinant Human LYVE1 cell lysate | +Inquiry |
LYVE1-1452MCL | Recombinant Mouse LYVE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYVE1 Products
Required fields are marked with *
My Review for All LYVE1 Products
Required fields are marked with *
0
Inquiry Basket