Recombinant Human LZIC Protein, GST-tagged

Cat.No. : LZIC-4527H
Product Overview : Human LZIC full-length ORF ( NP_115744.2, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LZIC (Leucine Zipper And CTNNBIP1 Domain Containing) is a Protein Coding gene. GO annotations related to this gene include beta-catenin binding. An important paralog of this gene is CTNNBIP1.
Molecular Mass : 47.9 kDa
AA Sequence : MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens ]
Official Symbol LZIC
Synonyms LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein;
Gene ID 84328
mRNA Refseq NM_032368
Protein Refseq NP_115744
MIM 610458
UniProt ID Q8WZA0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LZIC Products

Required fields are marked with *

My Review for All LZIC Products

Required fields are marked with *

0
cart-icon
0
compare icon