Recombinant Human LZTS1 Protein, GST-tagged
| Cat.No. : | LZTS1-4522H |
| Product Overview : | Human LZTS1 partial ORF ( NP_066300, 514 a.a. - 596 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing or nonmetastasizing tumor cells. This protein may have a role in cell-cycle control by interacting with the Cdk1/cyclinB1 complex. This gene is located on chromosomal region 8p22. Loss of heterozygosity (LOH) in the 8p arm is a common characteristic of many types of cancer. [provided by RefSeq, Nov 2009] |
| Molecular Mass : | 34.87 kDa |
| AA Sequence : | ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LZTS1 leucine zipper, putative tumor suppressor 1 [ Homo sapiens ] |
| Official Symbol | LZTS1 |
| Synonyms | LZTS1; leucine zipper, putative tumor suppressor 1; F37/Esophageal cancer related gene coding leucine zipper motif; leucine zipper putative tumor suppressor 1; FEZ1; F37/Esophageal cancer-related gene-coding leucine-zipper motif; F37; |
| Gene ID | 11178 |
| mRNA Refseq | NM_021020 |
| Protein Refseq | NP_066300 |
| MIM | 606551 |
| UniProt ID | Q9Y250 |
| ◆ Recombinant Proteins | ||
| LZTS1-460H | Recombinant Human LZTS1 Protein, His-tagged | +Inquiry |
| LZTS1-3525R | Recombinant Rat LZTS1 Protein | +Inquiry |
| LZTS1-5283M | Recombinant Mouse LZTS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LZTS1-3181R | Recombinant Rat LZTS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LZTS1-9418M | Recombinant Mouse LZTS1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LZTS1-4574HCL | Recombinant Human LZTS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LZTS1 Products
Required fields are marked with *
My Review for All LZTS1 Products
Required fields are marked with *
