Recombinant Human LZTS1 Protein, GST-tagged

Cat.No. : LZTS1-4522H
Product Overview : Human LZTS1 partial ORF ( NP_066300, 514 a.a. - 596 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a tumor suppressor protein that is ubiquitously expressed in normal tissues. In uveal melanomas, expression of this protein is silenced in rapidly metastasizing and metastatic tumor cells but has normal expression in slowly metastasizing or nonmetastasizing tumor cells. This protein may have a role in cell-cycle control by interacting with the Cdk1/cyclinB1 complex. This gene is located on chromosomal region 8p22. Loss of heterozygosity (LOH) in the 8p arm is a common characteristic of many types of cancer. [provided by RefSeq, Nov 2009]
Molecular Mass : 34.87 kDa
AA Sequence : ERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LZTS1 leucine zipper, putative tumor suppressor 1 [ Homo sapiens ]
Official Symbol LZTS1
Synonyms LZTS1; leucine zipper, putative tumor suppressor 1; F37/Esophageal cancer related gene coding leucine zipper motif; leucine zipper putative tumor suppressor 1; FEZ1; F37/Esophageal cancer-related gene-coding leucine-zipper motif; F37;
Gene ID 11178
mRNA Refseq NM_021020
Protein Refseq NP_066300
MIM 606551
UniProt ID Q9Y250

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LZTS1 Products

Required fields are marked with *

My Review for All LZTS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon