Recombinant Human MAD2L1, His-tagged
Cat.No. : | MAD2L1-28857TH |
Product Overview : | Recombinant full length Human Mad2L1 with an N terminal His tag ; mwt: 25.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 205 amino acids |
Description : | MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate.MAD2L1 is related to the MAD2L2 gene located on chromosome 1.A MAD2 pseudogene has been mapped to chromosome 14. |
Conjugation : | HIS |
Molecular Weight : | 25.700kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND |
Sequence Similarities : | Belongs to the MAD2 family.Contains 1 HORMA domain. |
Gene Name | MAD2L1 MAD2 mitotic arrest deficient-like 1 (yeast) [ Homo sapiens ] |
Official Symbol | MAD2L1 |
Synonyms | MAD2L1; MAD2 mitotic arrest deficient-like 1 (yeast); MAD2 (mitotic arrest deficient, yeast, homolog) like 1; mitotic spindle assembly checkpoint protein MAD2A; HSMAD2; MAD2; |
Gene ID | 4085 |
mRNA Refseq | NM_002358 |
Protein Refseq | NP_002349 |
MIM | 601467 |
Uniprot ID | Q13257 |
Chromosome Location | 4q27 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Amplificationof signal from unattachedkinetochores via a MAD2inhibitory signal, organism-specific biosystem; Amplification of signal from the kinetochores, organism-specific biosystem; |
Function | protein binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
Mad2l1-3895M | Recombinant Mouse Mad2l1 Protein, Myc/DDK-tagged | +Inquiry |
MAD2L1-5113C | Recombinant Chicken MAD2L1 | +Inquiry |
MAD2L1-6599H | Recombinant Human MAD2L1 protein, His-tagged | +Inquiry |
MAD2L1-28857TH | Recombinant Human MAD2L1, His-tagged | +Inquiry |
MAD2L1-672C | Recombinant Cynomolgus MAD2L1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAD2L1-4570HCL | Recombinant Human MAD2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAD2L1 Products
Required fields are marked with *
My Review for All MAD2L1 Products
Required fields are marked with *