Recombinant Human MAGEA10 protein, His-tagged
Cat.No. : | MAGEA10-3198H |
Product Overview : | Recombinant Human MAGEA10 protein(P43363)(1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-369aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.3 kDa |
AA Sequence : | MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MAGEA10 melanoma antigen family A, 10 [ Homo sapiens ] |
Official Symbol | MAGEA10 |
Synonyms | MAGEA10; melanoma antigen family A, 10; MAGE10; melanoma-associated antigen 10; cancer/testis antigen family 1; member 10; CT1.10; MAGE 10 antigen; melanoma associated antigen 10; MGC10599; MAGE-10 antigen; cancer/testis antigen 1.10; cancer/testis antigen family 1, member 10; |
Gene ID | 4109 |
mRNA Refseq | NM_001011543 |
Protein Refseq | NP_001011543 |
MIM | 300343 |
UniProt ID | P43363 |
◆ Recombinant Proteins | ||
MAGEA10-2231H | Recombinant Human MAGEA10 Protein (1-369 aa), His-tagged | +Inquiry |
MAGEA10-689H | Recombinant Human MAGEA10, GST-tagged | +Inquiry |
MAGEA10-3198H | Recombinant Human MAGEA10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA10-2125HCL | Recombinant Human MAGEA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGEA10 Products
Required fields are marked with *
My Review for All MAGEA10 Products
Required fields are marked with *
0
Inquiry Basket