Recombinant Human MAGEA6 protein, T7/His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MAGEA6 protein, T7/His-tagged

Recombinant Human MAGEA6 protein, T7/His-tagged

MAGEA6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MAGEA6-232H
Product Overview : Recombinant human MAGEA6 cDNA (2 – 314 aa, which derived from BC067731) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVE VTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLL KYRAREPVTKAEMLGSVVGNWQYFFPVIFIKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMP KTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFL WGPRALIETSYVKVLHHMVKISGGPRISYPLLHEWALREGEE
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : MAGEA6 melanoma antigen family A, 6 [ Homo sapiens ]
Official Symbol : MAGEA6
Synonyms : MAGEA6; melanoma antigen family A, 6; MAGE6; melanoma-associated antigen 6; cancer/testis antigen family 1; member 6; CT1.6; MAGE 6 antigen; melanoma antigen family A 6; melanoma associated antigen 6; MAGE-6 antigen; MAGE3B antigen; cancer/testis antigen 1.6; cancer/testis antigen family 1, member 6; MAGE3B; MAGE-3b; MGC52297;
Gene ID : 4105
mRNA Refseq : NM_005363
Protein Refseq : NP_005354
MIM : 300176
UniProt ID : P43360
Chromosome Location : Xq28
Function : molecular_function;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.