Recombinant Full Length Human MAGEA6 Protein
Cat.No. : | MAGEA6-296HF |
Product Overview : | Recombinant full length Human MAGEA6 with a N terminal proprietary tag; Predicted MWt 60.61 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 314 amino acids |
Description : | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been identified for this gene. |
Form : | Liquid |
Molecular Mass : | 60.610kDa inclusive of tags |
AA Sequence : | MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAAS SSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLW SQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQL VFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTG FLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIE TSYVKVLHHMVKISGGPRISYPLLHEWALREGEE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MAGEA6 melanoma antigen family A, 6 [ Homo sapiens ] |
Official Symbol | MAGEA6 |
Synonyms | MAGEA6; melanoma antigen family A, 6; MAGE6; melanoma-associated antigen 6; cancer/testis antigen family 1; member 6; CT1.6; MAGE 6 antigen; melanoma antigen family A 6; melanoma associated antigen 6 |
Gene ID | 4105 |
mRNA Refseq | NM_005363 |
Protein Refseq | NP_005354 |
MIM | 300176 |
UniProt ID | P43360 |
◆ Recombinant Proteins | ||
MAGEA6-296HF | Recombinant Full Length Human MAGEA6 Protein | +Inquiry |
MAGEA6-3419H | Recombinant Human MAGEA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGEA6-6788H | Recombinant Human Melanoma Antigen Family A, 6, His-tagged | +Inquiry |
MAGEA6-3200H | Recombinant Human MAGEA6 protein, His&Myc-tagged | +Inquiry |
MAGEA6-232H | Recombinant Human MAGEA6 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA6-4551HCL | Recombinant Human MAGEA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGEA6 Products
Required fields are marked with *
My Review for All MAGEA6 Products
Required fields are marked with *
0
Inquiry Basket