Recombinant Human MAGEA8 protein, His-tagged
Cat.No. : | MAGEA8-6754H |
Product Overview : | Recombinant Human MAGEA8 protein(1-318 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-318 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | MAGEA8 melanoma antigen family A, 8 [ Homo sapiens ] |
Official Symbol | MAGEA8 |
Synonyms | MAGEA8; melanoma antigen family A, 8; MAGE8; melanoma-associated antigen 8; cancer/testis antigen family 1; member 8; CT1.8; MAGE 8 antigen; MGC2182; MAGE-8 antigen; cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8; |
mRNA Refseq | NM_001166400 |
Protein Refseq | NP_001159872 |
MIM | 300341 |
UniProt ID | P43361 |
Gene ID | 4107 |
◆ Recombinant Proteins | ||
MAGEA8-6754H | Recombinant Human MAGEA8 protein, His-tagged | +Inquiry |
MAGEA8-1608HFL | Recombinant Full Length Human MAGEA8 Protein, C-Flag-tagged | +Inquiry |
MAGEA8-755H | Recombinant Human MAGEA8 protein, His&Myc-tagged | +Inquiry |
MAGEA8-28418TH | Recombinant Human MAGEA8, His-tagged | +Inquiry |
MAGEA8-1343H | Recombinant Human MAGEA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA8-4550HCL | Recombinant Human MAGEA8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGEA8 Products
Required fields are marked with *
My Review for All MAGEA8 Products
Required fields are marked with *