Recombinant Human MAGEA8 protein, His-tagged

• Cat.No.: MAGEA8-6754H
• Product Overview: Recombinant Human MAGEA8 protein(1-318 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-318 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: MAGEA8 melanoma antigen family A, 8 [ Homo sapiens ]
• Official Symbol: MAGEA8
• Synonyms: MAGEA8; melanoma antigen family A, 8; MAGE8; melanoma-associated antigen 8; cancer/testis antigen family 1; member 8; CT1.8; MAGE 8 antigen; MGC2182; MAGE-8 antigen; cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8
• mRNA Refseq: NM_001166400
• Protein Refseq: NP_001159872
• MIM: 300341
• UniProt ID: P43361
• Gene ID: 4107