Recombinant Human MAGEB18 protein, T7/His-tagged
Cat.No. : | MAGEB18-94H |
Product Overview : | Recombinant human MAGEB18 cDNA (2 – 343 aa, derived from BC029525), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-343 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSSAYLLFGD RPQNLPAAETPSIPEALQGAPSTTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKY ETKEPITKGDMIKFVIRKDKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKT GLLMIALGVIFLNGNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWG PRAHAETSKMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro MAGEB18 protein mediated germ cell, embryonic development regulation or tumor cell transformation study with "ProFectin" based intracellular delivery of this protein.2. May be used for MAGEB18 protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. Potential diagnostic biomarker protein for various cancer or auto-antingen for various auto-immuno-diseases.5. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | MAGEB18 melanoma antigen family B, 18 [ Homo sapiens ] |
Official Symbol | MAGEB18 |
Synonyms | MAGEB18; melanoma antigen family B, 18; melanoma-associated antigen B18; MGC33889; MAGE-B18 antigen; |
Gene ID | 286514 |
mRNA Refseq | NM_173699 |
Protein Refseq | NP_775970 |
MIM | |
UniProt ID | Q96M61 |
Chromosome Location | Xp21.3 |
Function | protein binding; |
◆ Recombinant Proteins | ||
MAGEB18-694H | Recombinant Human MAGEB18, His-tagged | +Inquiry |
MAGEB18-420C | Recombinant Cynomolgus Monkey MAGEB18 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGEB18-674C | Recombinant Cynomolgus MAGEB18 Protein, His-tagged | +Inquiry |
MAGEB18-94H | Recombinant Human MAGEB18 protein, T7/His-tagged | +Inquiry |
Mageb18-3902M | Recombinant Mouse Mageb18 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEB18-4546HCL | Recombinant Human MAGEB18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGEB18 Products
Required fields are marked with *
My Review for All MAGEB18 Products
Required fields are marked with *