Recombinant Human MAGEB18 protein, T7/His-tagged

Cat.No. : MAGEB18-94H
Product Overview : Recombinant human MAGEB18 cDNA (2 – 343 aa, derived from BC029525), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-343 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSSAYLLFGD RPQNLPAAETPSIPEALQGAPSTTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKY ETKEPITKGDMIKFVIRKDKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKT GLLMIALGVIFLNGNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWG PRAHAETSKMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro MAGEB18 protein mediated germ cell, embryonic development regulation or tumor cell transformation study with "ProFectin" based intracellular delivery of this protein.2. May be used for MAGEB18 protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. Potential diagnostic biomarker protein for various cancer or auto-antingen for various auto-immuno-diseases.5. May be used for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name MAGEB18 melanoma antigen family B, 18 [ Homo sapiens ]
Official Symbol MAGEB18
Synonyms MAGEB18; melanoma antigen family B, 18; melanoma-associated antigen B18; MGC33889; MAGE-B18 antigen;
Gene ID 286514
mRNA Refseq NM_173699
Protein Refseq NP_775970
MIM
UniProt ID Q96M61
Chromosome Location Xp21.3
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAGEB18 Products

Required fields are marked with *

My Review for All MAGEB18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon