"MAGEB18" Related Products

Recombinant Human MAGEB18 protein, T7/His-tagged

Cat.No.: MAGEB18-94H
Product Overview: Recombinant human MAGEB18 cDNA (2 – 343 aa, derived from BC029525), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSSAYLLFGD RPQNLPAAETPSIPEALQGAPSTTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKY ETKEPITKGDMIKFVIRKDKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKT GLLMIALGVIFLNGNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWG PRAHAETSKMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro MAGEB18 protein mediated germ cell, embryonic development regulation or tumor cell transformation study with "ProFectin" based intracellular delivery of this protein.2. May be used for MAGEB18 protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. Potential diagnostic biomarker protein for various cancer or auto-antingen for various auto-immuno-diseases.5. May be used for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: MAGEB18 melanoma antigen family B, 18 [ Homo sapiens ]
Official Symbol: MAGEB18
Synonyms: MAGEB18; melanoma antigen family B, 18; melanoma-associated antigen B18; MGC33889; MAGE-B18 antigen;
Gene ID: 286514
mRNA Refseq: NM_173699
Protein Refseq: NP_775970
MIM:
UniProt ID: Q96M61
Chromosome Location: Xp21.3
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.