Recombinant Human MAGEB2 protein, GST-tagged

Cat.No. : MAGEB2-695H
Product Overview : Recombinant Human MAGEB2 protein(1-319 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability October 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-319 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name MAGEB2 melanoma antigen family B, 2 [ Homo sapiens ]
Official Symbol MAGEB2
Synonyms MAGEB2; melanoma antigen family B, 2; melanoma-associated antigen B2; cancer/testis antigen family 3; member 2; CT3.2; DAM6; DSS/AHC critical interval MAGE superfamily 6; MAGE XP 2; melanoma associated antigen B2; MGC26438; MAGE-B2 antigen; MAGE XP-2 antigen; cancer/testis antigen 3.2; cancer/testis antigen family 3, member 2; DSS-AHC critical interval MAGE superfamily 6; MAGE-XP-2;
Gene ID 4113
mRNA Refseq NM_002364
Protein Refseq NP_002355
MIM 300098
UniProt ID O15479

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAGEB2 Products

Required fields are marked with *

My Review for All MAGEB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon