Recombinant Human MAGEB2 protein, GST-tagged

• Cat.No.: MAGEB2-695H
• Product Overview: Recombinant Human MAGEB2 protein(1-319 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-319 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MAGEB2 melanoma antigen family B, 2 [ Homo sapiens ]
• Official Symbol: MAGEB2
• Synonyms: MAGEB2; melanoma antigen family B, 2; melanoma-associated antigen B2; cancer/testis antigen family 3; member 2; CT3.2; DAM6; DSS/AHC critical interval MAGE superfamily 6; MAGE XP 2; melanoma associated antigen B2; MGC26438; MAGE-B2 antigen; MAGE XP-2 antigen; cancer/testis antigen 3.2; cancer/testis antigen family 3, member 2; DSS-AHC critical interval MAGE superfamily 6; MAGE-XP-2
• Gene ID: 4113
• mRNA Refseq: NM_002364
• Protein Refseq: NP_002355
• MIM: 300098
• UniProt ID: O15479