Recombinant Human MAGEB2 protein, GST-tagged
| Cat.No. : | MAGEB2-695H |
| Product Overview : | Recombinant Human MAGEB2 protein(1-319 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-319 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MAGEB2 melanoma antigen family B, 2 [ Homo sapiens ] |
| Official Symbol | MAGEB2 |
| Synonyms | MAGEB2; melanoma antigen family B, 2; melanoma-associated antigen B2; cancer/testis antigen family 3; member 2; CT3.2; DAM6; DSS/AHC critical interval MAGE superfamily 6; MAGE XP 2; melanoma associated antigen B2; MGC26438; MAGE-B2 antigen; MAGE XP-2 antigen; cancer/testis antigen 3.2; cancer/testis antigen family 3, member 2; DSS-AHC critical interval MAGE superfamily 6; MAGE-XP-2; |
| Gene ID | 4113 |
| mRNA Refseq | NM_002364 |
| Protein Refseq | NP_002355 |
| MIM | 300098 |
| UniProt ID | O15479 |
| ◆ Recombinant Proteins | ||
| MAGEB2-1264H | Recombinant Human MAGEB2 protein, His&Myc-tagged | +Inquiry |
| MAGEB2-1345H | Recombinant Human MAGEB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAGEB2-1305H | Recombinant Human MAGEB2 protein, His&Myc-tagged | +Inquiry |
| MAGEB2-695H | Recombinant Human MAGEB2 protein, GST-tagged | +Inquiry |
| MAGEB2-1723HFL | Recombinant Full Length Human MAGEB2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAGEB2-4545HCL | Recombinant Human MAGEB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGEB2 Products
Required fields are marked with *
My Review for All MAGEB2 Products
Required fields are marked with *
