Recombinant Human MAGOH, His-tagged

Cat.No. : MAGOH-30169TH
Product Overview : Recombinant full length Human MAGOH with a His-Tag at C-terminus; 154aa, 18.2kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 146 amino acids
Description : Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts.
Conjugation : HIS
Molecular Weight : 18.200kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.03% DTT
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNY KNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPP DRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR VFYYLVQDLKCLVFSLIGLHFKIKPILEHHHHHH
Sequence Similarities : Belongs to the mago nashi family.
Gene Name MAGOH mago-nashi homolog, proliferation-associated (Drosophila) [ Homo sapiens ]
Official Symbol MAGOH
Synonyms MAGOH; mago-nashi homolog, proliferation-associated (Drosophila); mago nashi (Drosophila) homolog, proliferation associated; protein mago nashi homolog; MAGOH1; MAGOHA;
Gene ID 4116
mRNA Refseq NM_002370
Protein Refseq NP_002361
MIM 602603
Uniprot ID P61326
Chromosome Location 1p32.3
Pathway Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function RNA binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAGOH Products

Required fields are marked with *

My Review for All MAGOH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon