Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MAGOH, His-tagged

Cat.No. : MAGOH-30169TH
Product Overview : Recombinant full length Human MAGOH with a His-Tag at C-terminus; 154aa, 18.2kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts.
Protein length : 146 amino acids
Conjugation : HIS
Molecular Weight : 18.200kDa inclusive of tags
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.03% DTT
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNY KNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPP DRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLR VFYYLVQDLKCLVFSLIGLHFKIKPILEHHHHHH
Sequence Similarities : Belongs to the mago nashi family.
Gene Name : MAGOH mago-nashi homolog, proliferation-associated (Drosophila) [ Homo sapiens ]
Official Symbol : MAGOH
Synonyms : MAGOH; mago-nashi homolog, proliferation-associated (Drosophila); mago nashi (Drosophila) homolog, proliferation associated; protein mago nashi homolog; MAGOH1; MAGOHA;
Gene ID : 4116
mRNA Refseq : NM_002370
Protein Refseq : NP_002361
MIM : 602603
Uniprot ID : P61326
Chromosome Location : 1p32.3
Pathway : Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function : RNA binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends