Recombinant Human MALT1 protein, His-tagged
Cat.No. : | MALT1-718H |
Product Overview : | Recombinant Human SHANK1 protein(Q9Y566)(Ala461-Gln620), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala461-Gln620 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 18 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | APGPTSGSQGQSQPSAPTTKLSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGSLGSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVANRSQESKQ |
Gene Name | SHANK1 SH3 and multiple ankyrin repeat domains 1 [ Homo sapiens ] |
Official Symbol | SHANK1 |
Synonyms | SHANK1; SH3 and multiple ankyrin repeat domains 1; SH3 and multiple ankyrin repeat domains protein 1; somatostatin receptor interacting protein; SPANK 1; SSTRIP; synamon; SSTR-interacting protein; somatostatin receptor-interacting protein; SPANK-1; |
Gene ID | 50944 |
mRNA Refseq | NM_016148 |
Protein Refseq | NP_057232 |
MIM | 604999 |
UniProt ID | Q9Y566 |
◆ Recombinant Proteins | ||
MALT1-9472M | Recombinant Mouse MALT1 Protein | +Inquiry |
MALT1-8151HFL | Recombinant Full Length Human MALT1, Flag-tagged | +Inquiry |
MALT1-717H | Recombinant Human MALT1, GST-tagged | +Inquiry |
MALT1-234H | Recombinant Human MALT1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Malt1-3911M | Recombinant Mouse Malt1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MALT1-4527HCL | Recombinant Human MALT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MALT1 Products
Required fields are marked with *
My Review for All MALT1 Products
Required fields are marked with *
0
Inquiry Basket