Recombinant Human MALT1 protein, His-tagged

• Cat.No.: MALT1-718H
• Product Overview: Recombinant Human SHANK1 protein(Q9Y566)(Ala461-Gln620), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Ala461-Gln620
• Tag: C-His
• Form: Phosphate buffered saline
• Molecular Mass: 18 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: APGPTSGSQGQSQPSAPTTKLSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGSLGSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVANRSQESKQ

Gene Information

• Gene Name: SHANK1 SH3 and multiple ankyrin repeat domains 1 [ Homo sapiens ]
• Official Symbol: SHANK1
• Synonyms: SHANK1; SH3 and multiple ankyrin repeat domains 1; SH3 and multiple ankyrin repeat domains protein 1; somatostatin receptor interacting protein; SPANK 1; SSTRIP; synamon; SSTR-interacting protein; somatostatin receptor-interacting protein; SPANK-1
• Gene ID: 50944
• mRNA Refseq: NM_016148
• Protein Refseq: NP_057232
• MIM: 604999
• UniProt ID: Q9Y566