Recombinant Human MALT1 protein, His-tagged

Cat.No. : MALT1-718H
Product Overview : Recombinant Human SHANK1 protein(Q9Y566)(Ala461-Gln620), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ala461-Gln620
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 18 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : APGPTSGSQGQSQPSAPTTKLSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPREGPAGGTGGSGGPGGSLGSRGRRRKLYSAVPGRSFMAVKSYQAQAEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVANRSQESKQ
Gene Name SHANK1 SH3 and multiple ankyrin repeat domains 1 [ Homo sapiens ]
Official Symbol SHANK1
Synonyms SHANK1; SH3 and multiple ankyrin repeat domains 1; SH3 and multiple ankyrin repeat domains protein 1; somatostatin receptor interacting protein; SPANK 1; SSTRIP; synamon; SSTR-interacting protein; somatostatin receptor-interacting protein; SPANK-1;
Gene ID 50944
mRNA Refseq NM_016148
Protein Refseq NP_057232
MIM 604999
UniProt ID Q9Y566

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MALT1 Products

Required fields are marked with *

My Review for All MALT1 Products

Required fields are marked with *

0
cart-icon