Recombinant Human MAMLD1 Protein, GST-tagged

Cat.No. : MAMLD1-2202H
Product Overview : Human CXorf6 partial ORF ( NP_005482, 603 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a mastermind-like domain containing protein. This protein may function as a transcriptional co-activator. Mutations in this gene are the cause of X-linked hypospadias type 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]
Molecular Mass : 36.63 kDa
AA Sequence : SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MAMLD1 mastermind-like domain containing 1 [ Homo sapiens ]
Official Symbol MAMLD1
Synonyms MAMLD1; mastermind-like domain containing 1; chromosome X open reading frame 6 , CXorf6; mastermind-like domain-containing protein 1; CG1; F18; HYSP2; CXorf6;
Gene ID 10046
mRNA Refseq NM_001177465
Protein Refseq NP_001170936
MIM 300120
UniProt ID Q13495

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAMLD1 Products

Required fields are marked with *

My Review for All MAMLD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon