Recombinant Human MAMLD1 Protein, GST-tagged
Cat.No. : | MAMLD1-2202H |
Product Overview : | Human CXorf6 partial ORF ( NP_005482, 603 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a mastermind-like domain containing protein. This protein may function as a transcriptional co-activator. Mutations in this gene are the cause of X-linked hypospadias type 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MAMLD1 mastermind-like domain containing 1 [ Homo sapiens ] |
Official Symbol | MAMLD1 |
Synonyms | MAMLD1; mastermind-like domain containing 1; chromosome X open reading frame 6 , CXorf6; mastermind-like domain-containing protein 1; CG1; F18; HYSP2; CXorf6; |
Gene ID | 10046 |
mRNA Refseq | NM_001177465 |
Protein Refseq | NP_001170936 |
MIM | 300120 |
UniProt ID | Q13495 |
◆ Recombinant Proteins | ||
MAMLD1-2202H | Recombinant Human MAMLD1 Protein, GST-tagged | +Inquiry |
MAMLD1-6647H | Recombinant Human MAMLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAMLD1-329H | Recombinant Human MAMLD1 Protein, MYC/DDK-tagged | +Inquiry |
MAMLD1-9478M | Recombinant Mouse MAMLD1 Protein | +Inquiry |
MAMLD1-5311M | Recombinant Mouse MAMLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAMLD1 Products
Required fields are marked with *
My Review for All MAMLD1 Products
Required fields are marked with *
0
Inquiry Basket