Recombinant Human MAMSTR Protein, GST-tagged

Cat.No. : MAMSTR-4320H
Product Overview : Human FLJ36070 full-length ORF (BAC04152.1, 1 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MAMSTR (MEF2 Activating Motif And SAP Domain Containing Transcriptional Regulator) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and transcription factor activity, RNA polymerase II transcription factor binding.
Molecular Mass : 59.2 kDa
AA Sequence : MPPEPRQGSRADPQAEGSALGPPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLRGLPVSGTKSMLLERMRGGAPPRERPKPRREDSPAGAPWPRLKPKALAAARRQGSVKPSAASHRPPLPRAADTPGTAPAPTPTPAPAAAPALTPSSGPGSAALTLEEELQEAIRRAQLLPNRGIDDILEDQVEPDDPLPPIPLDFPGSFDVLSPSPDSEGLSSVFSSSLPSPTNSSSPSPRDPTDSLDWLEALSGGPPLGSGPPPPSIFSADLSDSSSSRLWDLLEDPW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MAMSTR MEF2 activating motif and SAP domain containing transcriptional regulator [ Homo sapiens (human) ]
Official Symbol MAMSTR
Synonyms MAMSTR; MEF2 activating motif and SAP domain containing transcriptional regulator; MASTR; MEF2-activating motif and SAP domain-containing transcriptional regulator; MEF2-activating SAP transcriptional regulatory protein; likely ortholog of MEF2-activating SAP transcriptional regulator
Gene ID 284358
mRNA Refseq NM_001130915
Protein Refseq NP_001124387
UniProt ID Q6ZN01

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAMSTR Products

Required fields are marked with *

My Review for All MAMSTR Products

Required fields are marked with *

0
cart-icon