Recombinant Human MAMSTR Protein, GST-tagged

• Cat.No.: MAMSTR-4320H
• Product Overview: Human FLJ36070 full-length ORF (BAC04152.1, 1 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MAMSTR (MEF2 Activating Motif And SAP Domain Containing Transcriptional Regulator) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and transcription factor activity, RNA polymerase II transcription factor binding.
• Molecular Mass: 59.2 kDa
• AA Sequence: MPPEPRQGSRADPQAEGSALGPPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLRGLPVSGTKSMLLERMRGGAPPRERPKPRREDSPAGAPWPRLKPKALAAARRQGSVKPSAASHRPPLPRAADTPGTAPAPTPTPAPAAAPALTPSSGPGSAALTLEEELQEAIRRAQLLPNRGIDDILEDQVEPDDPLPPIPLDFPGSFDVLSPSPDSEGLSSVFSSSLPSPTNSSSPSPRDPTDSLDWLEALSGGPPLGSGPPPPSIFSADLSDSSSSRLWDLLEDPW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MAMSTR MEF2 activating motif and SAP domain containing transcriptional regulator [ Homo sapiens (human) ]
• Official Symbol: MAMSTR
• Synonyms: MAMSTR; MEF2 activating motif and SAP domain containing transcriptional regulator; MASTR; MEF2-activating motif and SAP domain-containing transcriptional regulator; MEF2-activating SAP transcriptional regulatory protein; likely ortholog of MEF2-activating SAP transcriptional regulator
• Gene ID: 284358
• mRNA Refseq: NM_001130915
• Protein Refseq: NP_001124387
• UniProt ID: Q6ZN01