Recombinant Human MAN1B1, His-tagged

Cat.No. : MAN1B1-135H
Product Overview : Recombinant Human Endoplasmic Reticulum Mannosyl-Oligosaccharide 1,2-α-Mannosidase/MAN1B1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp106-Ala699) of Human MAN1B1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 106-699 a.a.
Description : Endoplasmic Reticulum Mannosyl-Oligosaccharide 1,2-α-Mannosidase (MAN1B1) belongs to the glycosyl hydrolase 47 family. MAB1B1 is a single-pass type II membrane protein and widely expressed in many tissues. MAB1B1 is involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation. MAB1B1 can be inhibited by both 1-deoxymannojirimycin (dMNJ) and kifunensine. Defects in MAN1B1 are the cause of mental retardation autosomal recessive type 15 (MRT15). Mental retardation is characterized by significantly below average general intellectual functioning, it is also associated with impairments in adaptative behavior and manifested during the developmental period.
AA Sequence : DHWKALAFRLEEEQKMRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQI RPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRGAVIEPEQGTELPSRRAEVPTKPPLP PARTQGTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRSFSEWFGLGLTLIDALDTMWI LGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSLFLRKAEDFGNRLMPA FRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEAVEKVTQHIHG LSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEAIEGVR THLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMN RQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQ SFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEA HPLPIWTPAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name MAN1B1 mannosidase, alpha, class 1B, member 1 [ Homo sapiens ]
Official Symbol MAN1B1
Synonyms MAN1B1; mannosidase, alpha, class 1B, member 1; endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase; alpha 1; 2 mannosidase; endoplasmic reticulum alpha mannosidase 1; endoplasmic reticulum mannosyl oligosaccharide 1; 2 alpha mannosidase 1; ER alpha 1; Man9GlcNAc2 specific processing alpha mannosidase; MANA ER; ER alpha 1,2-mannosidase; Man9GlcNAc2-specific processing alpha-mannosidase; endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase 1; MRT15; ERMAN1; MANA-ER; FLJ37559;
Gene ID 11253
mRNA Refseq NM_016219
Protein Refseq NP_057303
MIM 604346
UniProt ID Q9UKM7
Chromosome Location 9q34.3
Pathway Asparagine N-linked glycosylation, organism-specific biosystem; Calnexin/calreticulin cycle, organism-specific biosystem; ER Quality Control Compartment (ERQC), organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem;
Function calcium ion binding; hydrolase activity, acting on glycosyl bonds; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAN1B1 Products

Required fields are marked with *

My Review for All MAN1B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon