Recombinant Human MAN1B1, His-tagged
| Cat.No. : | MAN1B1-135H |
| Product Overview : | Recombinant Human Endoplasmic Reticulum Mannosyl-Oligosaccharide 1,2-α-Mannosidase/MAN1B1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Asp106-Ala699) of Human MAN1B1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 106-699 a.a. |
| Description : | Endoplasmic Reticulum Mannosyl-Oligosaccharide 1,2-α-Mannosidase (MAN1B1) belongs to the glycosyl hydrolase 47 family. MAB1B1 is a single-pass type II membrane protein and widely expressed in many tissues. MAB1B1 is involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation. MAB1B1 can be inhibited by both 1-deoxymannojirimycin (dMNJ) and kifunensine. Defects in MAN1B1 are the cause of mental retardation autosomal recessive type 15 (MRT15). Mental retardation is characterized by significantly below average general intellectual functioning, it is also associated with impairments in adaptative behavior and manifested during the developmental period. |
| AA Sequence : | DHWKALAFRLEEEQKMRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQI RPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRGAVIEPEQGTELPSRRAEVPTKPPLP PARTQGTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRSFSEWFGLGLTLIDALDTMWI LGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSLFLRKAEDFGNRLMPA FRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEAVEKVTQHIHG LSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEAIEGVR THLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMN RQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQ SFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEA HPLPIWTPAVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | MAN1B1 mannosidase, alpha, class 1B, member 1 [ Homo sapiens ] |
| Official Symbol | MAN1B1 |
| Synonyms | MAN1B1; mannosidase, alpha, class 1B, member 1; endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase; alpha 1; 2 mannosidase; endoplasmic reticulum alpha mannosidase 1; endoplasmic reticulum mannosyl oligosaccharide 1; 2 alpha mannosidase 1; ER alpha 1; Man9GlcNAc2 specific processing alpha mannosidase; MANA ER; ER alpha 1,2-mannosidase; Man9GlcNAc2-specific processing alpha-mannosidase; endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase 1; MRT15; ERMAN1; MANA-ER; FLJ37559; |
| Gene ID | 11253 |
| mRNA Refseq | NM_016219 |
| Protein Refseq | NP_057303 |
| MIM | 604346 |
| UniProt ID | Q9UKM7 |
| Chromosome Location | 9q34.3 |
| Pathway | Asparagine N-linked glycosylation, organism-specific biosystem; Calnexin/calreticulin cycle, organism-specific biosystem; ER Quality Control Compartment (ERQC), organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem; |
| Function | calcium ion binding; hydrolase activity, acting on glycosyl bonds; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity; |
| ◆ Recombinant Proteins | ||
| MAN1B1-3972H | Recombinant Human MAN1B1 Protein (Asp106-Ala699), C-His tagged | +Inquiry |
| MAN1B1-135H | Recombinant Human MAN1B1, His-tagged | +Inquiry |
| MAN1B1-5791Z | Recombinant Zebrafish MAN1B1 | +Inquiry |
| RFL18306RF | Recombinant Full Length Rat Endoplasmic Reticulum Mannosyl-Oligosaccharide 1,2-Alpha-Mannosidase(Man1B1) Protein, His-Tagged | +Inquiry |
| MAN1B1-9482M | Recombinant Mouse MAN1B1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAN1B1-4526HCL | Recombinant Human MAN1B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAN1B1 Products
Required fields are marked with *
My Review for All MAN1B1 Products
Required fields are marked with *
