Recombinant Human MAN2A1 Protein, GST-tagged
Cat.No. : | MAN2A1-1427H |
Product Overview : | Human MAN2A1 partial ORF ( NP_002363, 1045 a.a. - 1144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which is a member of family 38 of the glycosyl hydrolases. The protein is located in the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse homolog of this gene have been shown to cause a systemic autoimmune disease similar to human systemic lupus erythematosus. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR |
Storage : | Store at -80 centigrade. |
Gene Name | MAN2A1 mannosidase alpha class 2A member 1 [ Homo sapiens (human) ] |
Official Symbol | MAN2A1 |
Synonyms | GOLIM7,MANA2,MANII |
Gene ID | 4124 |
mRNA Refseq | NM_002372 |
Protein Refseq | NP_002363 |
MIM | 154582 |
UniProt ID | Q16706 |
◆ Recombinant Proteins | ||
MAN2A1-6093Z | Recombinant Zebrafish MAN2A1 | +Inquiry |
MAN2A1-5315M | Recombinant Mouse MAN2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAN2A1-1427H | Recombinant Human MAN2A1 Protein, GST-tagged | +Inquiry |
MAN2A1-9484M | Recombinant Mouse MAN2A1 Protein | +Inquiry |
Man2a1-3375R | Recombinant Rat Man2a1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAN2A1-4525HCL | Recombinant Human MAN2A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAN2A1 Products
Required fields are marked with *
My Review for All MAN2A1 Products
Required fields are marked with *