Recombinant Human MAN2A1 Protein, GST-tagged

• Cat.No.: MAN2A1-1427H
• Product Overview: Human MAN2A1 partial ORF ( NP_002363, 1045 a.a. - 1144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which is a member of family 38 of the glycosyl hydrolases. The protein is located in the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse homolog of this gene have been shown to cause a systemic autoimmune disease similar to human systemic lupus erythematosus.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR
• Storage: Store at -80 centigrade.

Gene Information

• Gene Name: MAN2A1 mannosidase alpha class 2A member 1 [ Homo sapiens (human) ]
• Official Symbol: MAN2A1
• Synonyms: GOLIM7,MANA2,MANII
• Gene ID: 4124
• mRNA Refseq: NM_002372
• Protein Refseq: NP_002363
• MIM: 154582
• UniProt ID: Q16706