Recombinant Human MAN2B1 protein, His-tagged
Cat.No. : | MAN2B1-2719H |
Product Overview : | Recombinant Human MAN2B1 protein(51-342 aa), fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 51-342 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAN2B1 mannosidase, alpha, class 2B, member 1 [ Homo sapiens ] |
Official Symbol | MAN2B1 |
Synonyms | MAN2B1; mannosidase, alpha, class 2B, member 1; MANB; lysosomal alpha-mannosidase; LAMAN; mannosidase alpha-B; mannosidase, alpha B, lysosomal; lysosomal acid alpha-mannosidase; |
Gene ID | 4125 |
mRNA Refseq | NM_000528 |
Protein Refseq | NP_000519 |
MIM | 609458 |
UniProt ID | O00754 |
◆ Recombinant Proteins | ||
MAN2B1-2257Z | Recombinant Zebrafish MAN2B1 | +Inquiry |
MAN2B1-9486M | Recombinant Mouse MAN2B1 Protein | +Inquiry |
MAN2B1-43HFL | Recombinant Full Length Human mannosidase, alpha, class 2B, member 1 Protein, Flag tagged | +Inquiry |
MAN2B1-1550H | Recombinant Human MAN2B1 protein, His & T7-tagged | +Inquiry |
MAN2B1-5316M | Recombinant Mouse MAN2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAN2B1-4524HCL | Recombinant Human MAN2B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAN2B1 Products
Required fields are marked with *
My Review for All MAN2B1 Products
Required fields are marked with *