Recombinant Human MANBAL Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MANBAL-3183H
Product Overview : MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MANBAL (Mannosidase Beta Like) is a Protein Coding gene. Diseases associated with MANBAL include Colorectal Cancer, Hereditary Nonpolyposis, Type 7.
Molecular Mass : 9.5 kDa
AA Sequence : MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MANBAL mannosidase beta like [ Homo sapiens (human) ]
Official Symbol MANBAL
Synonyms MANBAL; mannosidase beta like; protein MANBAL; mannosidase beta A like; mannosidase, beta A, lysosomal-like
Gene ID 63905
mRNA Refseq NM_022077
Protein Refseq NP_071360
UniProt ID Q9NQG1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MANBAL Products

Required fields are marked with *

My Review for All MANBAL Products

Required fields are marked with *

0
cart-icon