Recombinant Human MANBAL Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MANBAL-3183H |
Product Overview : | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MANBAL (Mannosidase Beta Like) is a Protein Coding gene. Diseases associated with MANBAL include Colorectal Cancer, Hereditary Nonpolyposis, Type 7. |
Molecular Mass : | 9.5 kDa |
AA Sequence : | MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MANBAL mannosidase beta like [ Homo sapiens (human) ] |
Official Symbol | MANBAL |
Synonyms | MANBAL; mannosidase beta like; protein MANBAL; mannosidase beta A like; mannosidase, beta A, lysosomal-like |
Gene ID | 63905 |
mRNA Refseq | NM_022077 |
Protein Refseq | NP_071360 |
UniProt ID | Q9NQG1 |
◆ Recombinant Proteins | ||
MANBAL-2477R | Recombinant Rhesus Macaque MANBAL Protein, His (Fc)-Avi-tagged | +Inquiry |
MANBAL-2004HFL | Recombinant Full Length Human MANBAL Protein, C-Flag-tagged | +Inquiry |
Manbal-3917M | Recombinant Mouse Manbal Protein, Myc/DDK-tagged | +Inquiry |
MANBAL-5625C | Recombinant Chicken MANBAL | +Inquiry |
MANBAL-727H | Recombinant Human MANBAL, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MANBAL-4522HCL | Recombinant Human MANBAL 293 Cell Lysate | +Inquiry |
MANBAL-4521HCL | Recombinant Human MANBAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MANBAL Products
Required fields are marked with *
My Review for All MANBAL Products
Required fields are marked with *
0
Inquiry Basket