Recombinant Human MANEAL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MANEAL-982H
• Product Overview: MANEAL MS Standard C13 and N15-labeled recombinant protein (NP_001106954) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: MANEAL (Mannosidase Endo-Alpha Like) is a Protein Coding gene. Diseases associated with MANEAL include Wolf-Hirschhorn Syndrome. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is MANEA.
• Molecular Mass: 51.1 kDa
• AA Sequence: MARRRRRACIALFLVLLFAFGTLMGLRTLKAPDGLPALGPGLELAPFERRPEGAPAPAARAPAAPAAPPPPPPPPRTADPGGSPGPAPAEAEPAPVQSLRVYSDLHAFYYSWYGSPRREGHYIHWDHVMVPHWDPKISASYPRGRHSPPDDLGSSFYPELGPYSSRDPEVLREHMTQLKEAAIGVLVLSWYPPGMADDNGEPSDDLVPAILDTAHQYSIQVAFHIQPYKGRDDITVHDNIKYIIDTYGSHGAFYRYKNSMGKSLPLFYIYDSYLTSPEAWAHLLTPNGPHSIRNTPYDGVFIALLVEEGHTHDILAAGFDGMYTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNNHNTRNRVNGKYYETALQAALTVRPEIVSITSFNEWHEGTQIEKAIPKKTPTRLYLDYLPHQPSLYLELTRRWAEHFIKEKEQWLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MANEAL mannosidase endo-alpha like [ Homo sapiens (human) ]
• Official Symbol: MANEAL
• Synonyms: MANEAL; mannosidase endo-alpha like; glycoprotein endo-alpha-1,2-mannosidase-like protein; EC 3.2.1.130
• Gene ID: 149175
• mRNA Refseq: NM_001113482
• Protein Refseq: NP_001106954
• UniProt ID: Q5VSG8