Recombinant Human MANEAL Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MANEAL-982H |
Product Overview : | MANEAL MS Standard C13 and N15-labeled recombinant protein (NP_001106954) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MANEAL (Mannosidase Endo-Alpha Like) is a Protein Coding gene. Diseases associated with MANEAL include Wolf-Hirschhorn Syndrome. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is MANEA. |
Molecular Mass : | 51.1 kDa |
AA Sequence : | MARRRRRACIALFLVLLFAFGTLMGLRTLKAPDGLPALGPGLELAPFERRPEGAPAPAARAPAAPAAPPPPPPPPRTADPGGSPGPAPAEAEPAPVQSLRVYSDLHAFYYSWYGSPRREGHYIHWDHVMVPHWDPKISASYPRGRHSPPDDLGSSFYPELGPYSSRDPEVLREHMTQLKEAAIGVLVLSWYPPGMADDNGEPSDDLVPAILDTAHQYSIQVAFHIQPYKGRDDITVHDNIKYIIDTYGSHGAFYRYKNSMGKSLPLFYIYDSYLTSPEAWAHLLTPNGPHSIRNTPYDGVFIALLVEEGHTHDILAAGFDGMYTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNNHNTRNRVNGKYYETALQAALTVRPEIVSITSFNEWHEGTQIEKAIPKKTPTRLYLDYLPHQPSLYLELTRRWAEHFIKEKEQWLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MANEAL mannosidase endo-alpha like [ Homo sapiens (human) ] |
Official Symbol | MANEAL |
Synonyms | MANEAL; mannosidase endo-alpha like; glycoprotein endo-alpha-1,2-mannosidase-like protein; EC 3.2.1.130 |
Gene ID | 149175 |
mRNA Refseq | NM_001113482 |
Protein Refseq | NP_001106954 |
UniProt ID | Q5VSG8 |
◆ Recombinant Proteins | ||
MANEAL-982H | Recombinant Human MANEAL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MANEAL-5320M | Recombinant Mouse MANEAL Protein, His (Fc)-Avi-tagged | +Inquiry |
MANEAL-9492M | Recombinant Mouse MANEAL Protein | +Inquiry |
Maneal-3918M | Recombinant Mouse Maneal Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MANEAL-4519HCL | Recombinant Human MANEAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MANEAL Products
Required fields are marked with *
My Review for All MANEAL Products
Required fields are marked with *
0
Inquiry Basket