Recombinant Human MANSC1, His-tagged
| Cat.No. : | MANSC1-136H |
| Product Overview : | Recombinant Human MANSC Domain-Containing Protein 1/MANSC1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln27-Leu385) of Human MANSC1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 27-385 a.a. |
| AA Sequence : | QNCLKKSLEDVVIDIQSSLSKGIRGNEPIYTSTQEDCINSCCSTKNISGDKACNLMIFDTRKTAR QPNCYLFFCPNEEACPLKPAKGLMSYRIITDFPSLTRNLPSQELPQEDSLLHGQFSQAVTPLAHH HTDYSKPTDISWRDTLSQKFGSSDHLEKLFKMDEASAQLLAYKEKGHSQSSQFSSDQEIAHLLPE NVSALPATVAVASPHTTSATPKPATLLPTNASVTPSGTSQPQLATTAPPVTTVTSQPPTTLISTV FTRAAATLQAMATTAVLTTTFQAPTDSKGSLETIPFTEISNLTLNTGNVYNPTALSMSNVESSTM NKTASWEGREASPGSSSQGSVPENQYGLPFEKWLVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | MANSC1 MANSC domain containing 1 [ Homo sapiens ] |
| Official Symbol | MANSC1 |
| Synonyms | MANSC1; MANSC domain containing 1; MANSC domain-containing protein 1; FLJ10298; LOH12CR3; loss of heterozygosity 12 chromosomal region 3 protein; 9130403P13Rik; |
| Gene ID | 54682 |
| mRNA Refseq | NM_018050 |
| Protein Refseq | NP_060520 |
| UniProt ID | Q9H8J5 |
| Chromosome Location | 12p13.2 |
| ◆ Recombinant Proteins | ||
| MANSC1-2478R | Recombinant Rhesus Macaque MANSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MANSC1-2738H | Recombinant Human MANSC1 protein, His-tagged | +Inquiry |
| MANSC1-675C | Recombinant Cynomolgus MANSC1 Protein, His-tagged | +Inquiry |
| MANSC1-5321M | Recombinant Mouse MANSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MANSC1-3032C | Recombinant Chicken MANSC1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MANSC1-4518HCL | Recombinant Human MANSC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MANSC1 Products
Required fields are marked with *
My Review for All MANSC1 Products
Required fields are marked with *
